SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM474820-PA|EEB17619.1|RING from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM474820-PA|EEB17619.1|RING
Domain Number 1 Region: 193-286
Classification Level Classification E-value
Superfamily NRDP1 C-terminal domain-like 1.57e-39
Family USP8 interacting domain 0.0000212
Further Details:      
 
Domain Number 2 Region: 3-89
Classification Level Classification E-value
Superfamily RING/U-box 1.37e-20
Family RING finger domain, C3HC4 0.016
Further Details:      
 
Domain Number 3 Region: 79-149
Classification Level Classification E-value
Superfamily TRAF domain-like 0.000000000196
Family SIAH, seven in absentia homolog 0.007
Further Details:      
 
Weak hits

Sequence:  vb|PHUM474820-PA|EEB17619.1|RING
Domain Number - Region: 136-175
Classification Level Classification E-value
Superfamily Prefoldin 0.0112
Family Prefoldin 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM474820-PA|EEB17619.1|RING
Sequence length 286
Comment finger protein, putative|DS235817.1:455717:457185:1|gene:PHUM474820
Sequence
MGYDIGRFQGEVDEELLCPICTGVLEDPIQAPSCEHAFCRGCINEWVSRQPTCPVDRLVI
TSAHLRPVPRITRNLLSRLNINCDNALYGCSSVLKLNDLANHVEECEFNPKRPIPCDLGC
GLVIPKDEIKDHNCVKELRALIQKYQEKLSDFQQQLSEQRFQLEQQKQELSLLKEFMRAM
RVSNPNLRALADQMEQDEVVRWSATLPRARVTRWGGMISTPDALLQAAGLSSLETRQSNR
RSYENYVCKKVPGKQAVVVLHCDNHHMTDDMITEPGLLMIFAHGIE
Download sequence
Identical sequences E0VW63
vb|PHUM474820-PA|EEB17619.1|RING XP_002430357.1.24195 121224.XP_002430357

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]