SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM474950-PA|EEB17622.1|DNA from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM474950-PA|EEB17622.1|DNA
Domain Number 1 Region: 6-116
Classification Level Classification E-value
Superfamily Histone-fold 7.86e-28
Family TBP-associated factors, TAFs 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM474950-PA|EEB17622.1|DNA
Sequence length 127
Comment polymerase epsilon subunit, putative|DS235817.1:466894:467447:1|gene:PHUM474950
Sequence
MAEKLEDLNLPAAVVTRIIKEALPEGCNVAKEAKLALSRAASVFVLYLTSHANKISIGNG
KKIITNEDVMEAIQDTEFGRFEKQLNEAAEHFRKIQNSKKEALNQKKRLKEANQEEGQEN
MQMSLEY
Download sequence
Identical sequences E0VW66
121224.XP_002430360 vb|PHUM474950-PA|EEB17622.1|DNA XP_002430360.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]