SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM479110-PA|EEB17700.1|malonyl-CoA from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  vb|PHUM479110-PA|EEB17700.1|malonyl-CoA
Domain Number - Region: 56-164
Classification Level Classification E-value
Superfamily Proteasome activator 0.0149
Family Proteasome activator 0.0097
Further Details:      
 
Domain Number - Region: 342-392
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.0579
Family DBL homology domain (DH-domain) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM479110-PA|EEB17700.1|malonyl-CoA
Sequence length 485
Comment decarboxylase, putative|DS235819.1:174531:176834:-1|gene:PHUM479110
Sequence
MEDDCKYPDIFSNEDFVQRRLSTFEDVQVCISLLKEVLEYRKKNISSWIVESKVKQLCSF
YKCLIKNHRNEFIQVLSKDYAVNHYKVFQLSETLAKCSNISESDAKSDAKILKNEDQLRT
ILTPQYSWLFLNIGKLEKGVKFLVDLRTDVLELIAEKNSEVDSTVELQQLNSTLRDLLSL
WFSIGFLQLQRVTWNSPCEMLQKISEYEAVHPVRSWTDLKRRVGPYRRCFVFLHGSMPGE
PIVVLHTALCDEIASSMSGIEEDATCVKAAVFYSISSTQKGLQGIELGNYLIKSVVHELQ
IEFPQMTQFSSLSPIPNFKTWLIDKVKFAEKGSNDILLHDEIITLKKHLNSSSDFWKDFK
KILLSNAWAEDKNLVSLLEKPLMRLCARYLFIEKRRGYAFDSVANFHLKNGAVLWRLNWS
ADLSPRGLGNSCSMMVNYRYFLEDTESNSRAYLENFSIPASEQILNLAEQAKQKIVCNSD
SWKYL
Download sequence
Identical sequences E0VWE9
XP_002430438.1.24195 121224.XP_002430438 vb|PHUM479110-PA|EEB17700.1|malonyl-CoA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]