SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM479450-PA|EEB17704.1|dynamin from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM479450-PA|EEB17704.1|dynamin
Domain Number 1 Region: 5-304
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.44e-88
Family G proteins 0.000000000245
Further Details:      
 
Domain Number 2 Region: 518-625
Classification Level Classification E-value
Superfamily PH domain-like 7.12e-24
Family Pleckstrin-homology domain (PH domain) 0.00000548
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM479450-PA|EEB17704.1|dynamin
Sequence length 824
Comment putative|DS235819.1:188864:196576:1|gene:PHUM479450
Sequence
MAGNTGMEQLIPIVNKLQDAFTQLGVHMQLDLPQIAVVGGQSAGKSSVLENFVGRDFLPR
GSGIVTRRPLILQLVNASVEYAEFLHCKGKKFVDFNEVRLEIEAETDRVTGSNKGISNIP
INLRVYSPNVLNLTLIDLPGLTKVPVGDQPADIESQIKGMIFQFITKENCLILAVTPANT
DLANSDALKLAKEVDPQGIRTIGVITKLDLMDEGTDARDILENKLLPLRRGYIGVVNRSQ
KDIDGRKDISAALAAERKFFLSHPQYRHIADRLGTPYLQRVLNQQLTNHIRDTLPGLRDK
LQKQLLTLEKDVEQYKYFRPDDPAIKTKAMLQMIQQLQSDFERTIEGSGSAQINTMELSG
GAKINRLFHERFPFEIVKMEFDEKELRREIAFAIRNIHGIRVGLFTPDMAFEAIVKKQIS
RLKEPSLKCVDLVVQELSNVVRVCTDKMNRYPRLREETDRIITTHIRKREQTCKDQIILL
IDCELAYMNTNHEDFIGFANAQNQTENSVKSGRKLGNQVIRKGFMCIHNLGIMKGGSKDY
WFVLTSENISWYKDEEEKEKKYMLSLDGLKLRDVEQGFMSRRHTFALFNPEGRNVYKDCK
QLELSCETQEEVDSWKASFLRAGVYPEKSTEPTNGEEGSNEGSSSMDPQLERQVETIRNL
VDSYMKIVTKTTKDLVPKTIMMLIINNAKDFINGELLAQLYASGDQATMMEESPEEALKR
EEMLRMYHACKEALKIIGDVSMATVTTPVPPPVKNDWLASGLDSTRRGVPPQVNIGAAQN
RPPPQPPSTGRPAPAIPNRPGPGGPPMPPGRPAGAGLPPPLIPS
Download sequence
Identical sequences E0VWF3
XP_002430442.1.24195 121224.XP_002430442 vb|PHUM479450-PA|EEB17704.1|dynamin

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]