SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM479490-PA|EEB17708.1|leucine-rich from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  vb|PHUM479490-PA|EEB17708.1|leucine-rich
Domain Number - Region: 71-157
Classification Level Classification E-value
Superfamily PH domain-like 0.00902
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM479490-PA|EEB17708.1|leucine-rich
Sequence length 818
Comment repeat flightless-interacting protein, putative|DS235819.1:211031:215757:1|gene:PHUM479490
Sequence
MDDDDFDFTPSSNTSSNLASLFGFIKKPLPGNSNLTYTAPKPPKKENTSSKNQQQKEENT
NKSTVIFYKPVQAYKYENKVYIHQGLTGIVITRNHMSHNYDIILYKPSKETLVTIGITKF
FTLTVSANNYVSFYDSNNQNWSIMFQSSNDLEEFLEKSFTNSFVDVTYSTFSLDEQSVIA
IKDNIKEKIHLSDSSSLAKGLAGCSENSKRVVILPNLLCDSSFTNQNVGKHLLLKINIGK
IVSELQNTLINSKSVEEEVESPNESSSEDLSNKAKAQSIREALATTKSQKANLISRMARM
GQATLPLKTSTGPSDSEEEIPVTATVKSKSPRNKLSNSNVSHHHHYYQENTEGVKQLSIY
QNEFPLQHSKKSSVSQQLTPVFQSPVLSPTGDPSFSVYLSESRIQATELRMGISKISEKV
DQVLNKIQNLQLPNTSVQLQPSSFVDSHGLLTSIQNLVTKNESLEAKVEEQKNKLELQND
KIFHLLELNQTCLEKNSFTFEKQSETESKLRQEMESVLKKELILEEDNKKSTEKIKILER
QLQNSEEIKKKLEETSAELVNQLNKLKKEVEDKKSAKLDRENYDETMAKASEIVTKLKEK
LKEAVREKEELKTVIRTQSENIETFENKILDLTTNNIEYEKIVKDLNSRILADESELKEK
LSSYKKSQEKLEDEKKFFITKYEKEKENLKSEWKNAISQSILKLSENFNENEKYTKKEIM
FFVSKCFDNVNTNKNELEIKENKGILDDKKFEKVFESDDMHSNSKKASEPTISNTLNAEK
KLNTIFGMPLYRYHPKCFGKYGRDFMAGYQYFTEIILV
Download sequence
Identical sequences E0VWF7
121224.XP_002430446 XP_002430446.1.24195 vb|PHUM479490-PA|EEB17708.1|leucine-rich

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]