SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM486740-PA|EEB17745.1|oxysterol from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM486740-PA|EEB17745.1|oxysterol
Domain Number 1 Region: 376-739
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 4.58e-112
Family Oxysterol-binding protein 0.00001
Further Details:      
 
Domain Number 2 Region: 4-97
Classification Level Classification E-value
Superfamily PH domain-like 6.56e-22
Family Pleckstrin-homology domain (PH domain) 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM486740-PA|EEB17745.1|oxysterol
Sequence length 753
Comment binding protein 9, putative|DS235821.1:73249:97866:-1|gene:PHUM486740
Sequence
MTRPSLEGPLTKWTNVMKGWQHRWFVLDENSGLLSYYTSREKMMRGVRRGCVRLKGAILG
IDNEEDGNFTITTDSKTFHFQARNLAEREVWVRALEDTILRHAVFTHEHQVQPIVFLRKH
MPHQLLKVHFEEEEDCSYETNMKKFDNRISQADVLLQMLIEQTQSLDSQIDGIEDESLKS
QLGKLSHNYNLLVGGVKLAIVLLQILKLQHQHQQQQPRRGSRELLPSDDNTSETQSYTEP
TPGTIELGSDCLNNPILMPAVIESLSHVASPEGMTLIVPPEIVPETSYSSSDDDEDFFDA
DDDLNSSVTANRTTSANFIVGNGVKESSSTQLTNVPGTSKKSSSSGASSPPVRIDGSLDY
DALYEDDEDQSDISMENHGSMITHLLSQVKIGMDLTKVVLPTFILETRSLLEMYADYFAH
PDMFVSIADKKTPKDRMVQVVKWYMSAYHAGRKSTVAKKPYNPILGEIFQCYWNIPGFTE
TADSTPVDDGPMPWCTRGQLAFIAEQVSHHPPISAFYAECVAKKICFEAFVYTKSKFLGL
SVGVHNIGHGTVHVLDFKEDYVLTFPSGYGRSILTTPWIELGGTVTISCKKSGYNANIEF
HTKPFYGGKKHRITGEIYGPSEKKPFITISGEWNGVMESKNAETGRVEVFVDVLKTPVTK
KIVQSVFEQKENESRNLWKDVTAGLRLNDIDKATMAKTMLEQKQRDEAKKRRDTGTSWET
KLFYEKSEGDWRYKTPLSSRQEDSSYITSVREQ
Download sequence
Identical sequences E0VWI8
vb|PHUM486740-PA|EEB17745.1|oxysterol XP_002430483.1.24195 121224.XP_002430483

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]