SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM488870-PA|EEB17777.1|predicted from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM488870-PA|EEB17777.1|predicted
Domain Number 1 Region: 749-1024
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 2.33e-43
Family Patatin 0.043
Further Details:      
 
Domain Number 2 Region: 69-207
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.09e-23
Family cAMP-binding domain 0.012
Further Details:      
 
Domain Number 3 Region: 330-451
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.0000000000000314
Family cAMP-binding domain 0.015
Further Details:      
 
Domain Number 4 Region: 467-534
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.000000000314
Family cAMP-binding domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM488870-PA|EEB17777.1|predicted
Sequence length 1127
Comment protein|DS235822.1:237472:246825:1|gene:PHUM488870
Sequence
MLRKVKSISGQVHQTKKRKLVMRFARRILHLKKDTSSMQLQVLEPPAEYLEEDITSKYDQ
GLPPDALYLLQSLRVFGHFEKPVFLMLCKHTEILTVPAGAFLFKIGDPDENVYVVQSGCL
NVFITEHNGTMISLKYVKAGESVTSLLSFTDVLTGSPSVYKTVSARAMEDTTIVRLPIQA
FNEVFHDYPDIFIRVVQVIMVRLQRVTFTALHQYLGLSAELVRSNTHFVNNYQTINTSQK
SQRSSLGEENNEVTKIRNVPFSGPLDFKIINQKFVPFSEIFLRQNAKIFATNAGNQNAPI
ESEIQMTGHRRSMSGKVNSLAEDYDSLMQLAKAAFVRELNLENESILDGKIEIKDVPTGT
YLMRQDSHKDVALIYLLSGALVLSQKMTDDQHEVHMFTAHPGEVIGGLAVLTGEPSFFTM
KAKHFSKIAMLSKSTFYEIVYLHKTVYILLFNNESVSQSSFICSPYRKLVGEYGKGDLVG
IVEMVTQTPRSTTVMAVRDSELAKLPEGLFNAIKLRFPIVVTRLINLLGHRLLGTKGHPG
VGLNPGAGARPSQVNFSTVAIVPISDDVPLTAFGFELYHALCAIGLTLRLTSDLIKKTLG
ATIMDPNNEYRLTSWLAQQEDQHKIALYQCDASLTPWTQRCVRQADCILIIGLAEKGPDL
GKMEKEVERLAVRTQKELVLLHRESTERPSNTVLWLNARTWVSSHHHIKCNKRMFSRRSQ
YRINELYKKVLMSEPNIHSDFSRLARWLTGTSVGLVLGGGGAGIPIDMVGGVSIGSFVGG
LWAMEKTLRRDSKAREWSKKMTQWYRQILDLTYPVVSIFTGKDFNHTIYSTFGDINIEDL
WIPYFNVTTDISASASRVHKHGFLWKYIRASMSISGVLPPICDPVDGHLLCDGCYVNNVP
ADVMRNEGARHILAIDVGAHDDQDLTNYGDSLSGFWLLYKKWNPFTKPVKVPDLSDIQSR
LSYVCCVRQLEEVKNSDYCEYLRPPIDKYKTLQFALFDEIKEVGYTYGKTYFARLLKAGV
LPLFKTDIVATRRPFASHPTYTFTDLAQMVCKVPRKHVTADMSSSTSETEDDDDDDDDIN
VGYASEPSAFILSKNSTANVPRRGQSLSENELDSETNFLTDEASDAR
Download sequence
Identical sequences E0VWM1
XP_002430515.1.24195 121224.XP_002430515 vb|PHUM488870-PA|EEB17777.1|predicted

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]