SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM489240-PA|EEB17785.1|cyclic-nucleotide-gated from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM489240-PA|EEB17785.1|cyclic-nucleotide-gated
Domain Number 1 Region: 3-189
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 4.84e-45
Family cAMP-binding domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM489240-PA|EEB17785.1|cyclic-nucleotide-gated
Sequence length 380
Comment cation channel, putative|DS235823.1:1603:4278:1|gene:PHUM489240
Sequence
MFLAKLDGVKTYMRMRRVPNHLQVKVIKWFDYLWLTQKCSDEEKAVSCLPAEIAINVHLD
TLKRVEIFQNTEAGFLCELVLRLRPVLFSPGDYICRKGEVGKEMYIVNRGRLQVVADNGK
TVLATLKAGSYFGEISILNMGTAGNRRTASVRSVGYSDLFVLSKKDMWDVLKEYPAARVR
LEAIAVKRLEKYKRAPLEKAAMGRSHSTPGLVESRGRVALEEMWISPIGLAVDDNAHNSP
TLTSRSAPAVAQNVRSTESPLSPSSSVRSSEIHHHSHVHSHPTSQRPSTVQMGASFNSMT
HLVEGDSNCLICQDSLLAEIKRLRNRLITLETENAAMSMKLSKQQWEVEHRLAEIEMQIC
GGSSAESSTEDNERNKESII
Download sequence
Identical sequences E0VWM9
vb|PHUM489240-PA|EEB17785.1|cyclic-nucleotide-gated XP_002430523.1.24195 121224.XP_002430523

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]