SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM491620-PA|EEB17863.1|conserved from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM491620-PA|EEB17863.1|conserved
Domain Number 1 Region: 163-303
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.86e-26
Family DBL homology domain (DH-domain) 0.0013
Further Details:      
 
Domain Number 2 Region: 667-827
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0000000097
Family WD40-repeat 0.037
Further Details:      
 
Domain Number 3 Region: 299-404,465-498
Classification Level Classification E-value
Superfamily PH domain-like 0.000000148
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM491620-PA|EEB17863.1|conserved
Sequence length 998
Comment hypothetical protein|DS235824.1:237175:243815:-1|gene:PHUM491620
Sequence
MTCCCPQQQEQLGDDKCKHKNHDRAIKILKNFDCQKDRDKFFNSSDTNLWNKQYNDNNNN
NNNNGFSLKDCDASWCATVEETQQSMRMQEIVMIQMRDKLLMNRCKFKASIKPNEKIQRL
IEEKKKCTGDIEIIEELLCQVKKELDCTKMQFEKYLEKNNQENKQNKQKCDTRTHVVVEL
FDTEKSYVESLQIIARKYLRPLKSPENVGLVDTVVVDEIFYQAMAREHRGKLALDSLIIM
PVQRIPRYELLIQRLLKHTDSNHPDYALLMAAQHKIHELAVKINLTERETIEMEHQQQIL
KDLEALIEGLVDLTSNDRTFVRHDTVTMASGQGTRKERALFLFSDLLIITSIKRRSGTIR
KPSATCTGTTVASSLDANKYKLLMRIPIDDLEVVKTAKDDNVKKMMKEIQKLSEDVCVLT
QISDLTLTLQCPRTSLEEIVKDMLSNVNKQLAERQTSDSQLSYLELMLNTQHGMENVSVV
FTKPEKRSSWEESFNDCKQKLALSADRKPSPEFMASVPIRKTRAGLQFTCAAPTLGLNAF
NLRDVWVCNSDGYVGQVCVLSLQPEPTVTSCNGVCNARLLCIASIPAGVTKLSKNVQKKS
DVESDVSSGVEEHSDKSRSVELISSSSSDEDDDDANKEFFARRSKSEPLSTTETGEGGIE
DAENQQPTMWLGTEDGNIHVYLCSDNIRIKKNKVKIQHTSSVQSIIYLDNRVFVSLSNGD
IIVYSRDQAGGWNTSNPSTITVGTPNAPVNKMTPVDGKLWCGCHNNIKILNTNPLQIEHS
FQASTDGLKIVTGMAVSGFGVWISLQNSAVIKLFHSVTYENLCDVNVAPSVTKMLAGCDD
IIRQHKAACLRVTSLLACKDLLWIGTSAGVVLNMTIPHISMSTTKLTSVPNVTGVPHGHT
GHVRFLTCVETTGNPKQTDNSIKHNSNNSTARKQHHNIKNKMDSQLGGGGGGGCGGGGGP
SKMLVISGGDGYEDFRNSNTSEVAGREDSTNHLLLWQI
Download sequence
Identical sequences E0VWV7
vb|PHUM491620-PA|EEB17863.1|conserved 121224.XP_002430601 XP_002430601.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]