SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM491790-PA|EEB17870.1|conserved from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM491790-PA|EEB17870.1|conserved
Domain Number 1 Region: 333-458
Classification Level Classification E-value
Superfamily Second domain of FERM 3.66e-28
Family Second domain of FERM 0.0011
Further Details:      
 
Domain Number 2 Region: 82-188
Classification Level Classification E-value
Superfamily PDZ domain-like 7.9e-16
Family PDZ domain 0.01
Further Details:      
 
Domain Number 3 Region: 239-293
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000977
Family Ras-binding domain, RBD 0.022
Further Details:      
 
Domain Number 4 Region: 468-556
Classification Level Classification E-value
Superfamily PH domain-like 0.00000897
Family Third domain of FERM 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM491790-PA|EEB17870.1|conserved
Sequence length 1440
Comment hypothetical protein|DS235824.1:329763:340586:1|gene:PHUM491790
Sequence
MLFEVNFIHYNGRKRTKCKLNFQNEQKQPKQRPKQQQQQLQQESKGKKFFFYLTQTTSWI
PPVESWTGDFPYGWEEGFDHDGKSYYINHLNKTTTYEDPRKDWSEEPPLPREVTLTRHPE
MGFGFVAGSEKPVIVRFVTEGGPSVDLLLPGDQILSVNGENVKKAPRDHVIKLVRACKDV
VRLTVSQPPLDNSTRKSALLSAAKKAKLKSNPSRVRFAEGVVVNGSPPSMFSNGESCIPV
LPNVLKVYLENGQTKSFKYDSTTTVQDVVTSLLQKLCIWSSEHFSLVVEHYKSLRRNKLT
LLDPRESVARVAARPGSHNLRCLFRVTFMPKEAAELAQKDLVAFEYLYMQCCNDVVQERY
APELKYDLALRLAALHIHQHALAHNLAGKLTIKGVEREFGLERFVPVSLLTTMKRKELRK
LLAHFLKLNQNILPGQKSLTSFQAKLHYLNIVSELPSYGAKCFSTNIRDANMETVLLVSP
KFGISQILGIRNSVPVALANVEDVRGIVVRREDELSRLIRIFLINNRELIFSLEDRDADE
LVLILKGYYHLFTGENVDVDEERDPWPEDCAPLYMSPHEVCPASWSYLNSRESRTRVVNF
SMIPYYQPSTDTINGRMNGHVGMKTSSGTTSQQSSSSLPPSLGEKCGVDSNIPVPDGKKN
YQNGGLQNGSLNSLDAKNDEVLKRVAEMQALVLTSEQYLTEQTETNHHHQHQHQQSLGRI
TKLHEEEDSEESHISSGESEIPAPGELKHSDSLLLLTQFVIFIRLVVAQVSNSVNELEDV
VKSLDIDDVEPSESDTDSASTPAGSPSQSKARMSDKNRHSTQSFGLHSPDGITSTSCEFQ
AYLQRLKDDKEFDFESENGTFYFDPDIIDLTNIPPPPTPDDGVNPLPIQPSFPPTPFADG
DNNKVEPSIYWGEEEQESMVPESQVDDDLEAFLATVAVAPPDHAHKITTEEILSYIIPPP
PKTAAPSTSSFSTISLDNNTKNVVDETKTREAFQQPLMKRNGLENETSSKQNGHVTSSFS
PKLGWKDSSSSSSFCGDRSGLIQKDRRQLLCNNNNTNNTINANTSDLPPKCQKLIQVSEW
PRKDGPLKLSLLGVGGGSGGGGDVSDGDICNCGSFGNATTIASSQYDSLPKSLARYPTHH
QDGLSGCGVGKSPSASSTYGTLPKTKFYEIDHNNDTYNNKSGTLITKGISGSRNVTFGTP
PTRDSSPPVNYLPRNGLVMYRTCRDDFTQQHHHHQHPQHPPSHRGFQQQQQNNFGIIHPG
VSRSERECQHHHPHPHQIDSREIRDKNDDALGILLVRLDQLAAECDRAQGQGGGHHINEE
KFQVAKNSAAETTQELLSISKSLIKNFLSSSSSSSSSLPSPSPETETESRKFLDNVKKLC
ERCTEMCAHTSSPVHTRNIILRVHDVATAYRELQRNKNHKQSDYLNDMLTSLSRSLKVFE
Download sequence
Identical sequences E0VWW4
XP_002430608.1.24195 vb|PHUM491790-PA|EEB17870.1|conserved 121224.XP_002430608

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]