SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM492360-PA|EEB17907.1|conserved from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM492360-PA|EEB17907.1|conserved
Domain Number 1 Region: 354-536
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.94e-24
Family DBL homology domain (DH-domain) 0.00083
Further Details:      
 
Domain Number 2 Region: 199-280
Classification Level Classification E-value
Superfamily PDZ domain-like 1.71e-18
Family PDZ domain 0.019
Further Details:      
 
Domain Number 3 Region: 22-100
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000000000000223
Family Synaptotagmin-like (S variant) 0.004
Further Details:      
 
Domain Number 4 Region: 574-642,671-701
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000242
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM492360-PA|EEB17907.1|conserved
Sequence length 783
Comment hypothetical protein|DS235824.1:712534:719385:1|gene:PHUM492360
Sequence
MHVHERNSRGSVRKVALVPSAERTFFRTPVHRESSCPNFNETFSFNFHSEDLNKHILVSV
WHRDRDNRKSEFLGCVSLAVKNAIKKEISGWFRLVAQSGGSKSSSNQQRPIQSNCGLSTT
GSPSMMAHRSGNQKFDELIPFDDEPRSSPPDKHNNKYSIKKKLNDDSSFLRHLELEPIDG
EGGRVPLPEAIAKGGRTPFTTTKQLTKQPGGGFGFSIAWVQPPRVERVEAGQPADRAGIR
PGDFVIFVDRFNVVTMSEEEILDIIKSCGNELTLEIYRKSNANGCLVEPPIALPSTMQTS
VEYNNSSRWSGTCYAPTGTTNTTTTTTTSTSFDFAKRRLHLPQVAFTNEVSTLNPEESRK
KAIYQLLSKEQNYATNLQFGINRFSVPLLERKEFINQKQHQILFQNIEEILRLTEDTLEQ
AINEEVDLTGDSIGRLYFKRIQVLKPAYRRYCSGIKRADCVLAEKFKNNEFNRFCAEPPV
PRKRPDLTTFLHKPLEHYRELLKHLQIIFNLTKSPDTDHAALSRVVNDMQSSFREVTGGL
MEPEVEGRPLLSVQDLESRLVFTRCKPFVLSIPGRQWIFGGDLSKIEGRTVHPFWALLFT
DMMIFAKVSRDRVLFITEEPLSLLAVSQAFFNIRKKANEFRLLLSNNSPGMDSPANSTTC
GPDIVLSRTPKKNTKFKSIALRAPTPELKAVWQNLIQRQIIHLNTTRGLTPSTSPLESPD
PPTTISAATLDTISLKRQMRLPQVYSCSPNHVPRDDEDETSSPPPEKFYYEPLLTPDSAT
TFG
Download sequence
Identical sequences E0VX01
vb|PHUM492360-PA|EEB17907.1|conserved XP_002430645.1.24195 121224.XP_002430645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]