SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM492460-PA|EEB17915.1|Rho-type from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM492460-PA|EEB17915.1|Rho-type
Domain Number 1 Region: 763-958
Classification Level Classification E-value
Superfamily Bet v1-like 1.24e-52
Family STAR domain 0.00000057
Further Details:      
 
Domain Number 2 Region: 514-683
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.55e-41
Family BCR-homology GTPase activation domain (BH-domain) 0.001
Further Details:      
 
Domain Number 3 Region: 3-44
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000000989
Family Variant SAM domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM492460-PA|EEB17915.1|Rho-type
Sequence length 969
Comment GTPase activating protein, putative|DS235824.1:854715:859020:1|gene:PHUM492460
Sequence
MSDLQFPIDVSGVQKDHPFLDKDSLQSLFRRLHALNRCAKMKIDNPPKNSMDDSDEDDQC
ALSEKWTFQPESRRWSRLCDVADHHHHHHHHYHHHGQNGHHGDHNNLHNNTTGSSNTSEE
KPDSSLESSDRLMSSGEDLIATEDGGGPIIENFRYGSLPQGSISADSELLAVRFRRTNSE
KLRDSAKAILRRMESLKSRRRKKQNVDNVIISGPKVVDIPTMQQKMKDLNCVEVSSTATS
GSSPENFSPSFYYLPPLCHYPSPPPFADDSSSYCSDNSQGTPVYQRTKNKLHRAKKFFHH
HSRKSDESGALSDSEIQPTSWKHKYVKDANSNHAKVVDYIDGRPRGPKDREPPGTSKTPS
RGGSLNLGKESQRYREQVQANFRRKGGNTCINKSGSSELTEDSSGTFASHPDSDQDPMDI
TTRQRVTVVRWHSFQRGSLRRDSYYLNSDSNIPLEYRSMNALSCGQLLVLKKMSLLKLTA
CMEKYCPTHRTGWNWELPKFIRKIKTPDYKDKTVFGVPLLLSLQRSGQALPKCIQLALRW
LRINALDQVGLFRKSGVRSRIQTLKTMTENQGELISYDGHQAYDVADMVKQYFRELPEAL
LTNKLSETFISIFQHVPESYRKDAVQWALLLLPDEHREALQTVLEFLNQVSARSTCNQMT
ASNVAVCLAPSLFHLHHPSPNSMSRSSSASPRRRKTVGVPDQRELGENRAAHDCLLYLMK
ENKEIFTVSEDMFSSCRFSTMDYSIPMTLEQLGSELVDGWRGYLRESISSFLREAKEKSR
GWVSVPCSLDSFTDMAYKKVGDGHPLRLWKVWTEVEAPPQELVRRVLRERHLWDLSLLKW
RVVARLDAQAEIFQFVCGSMPPLPAKDFCVLRSWKTDLPKGACVIVETSVEHPDASVLLG
GVRGVVLASRYLIEPCGSGKSRITHLSRVDTKGRSPEWYNKSYGHICAMHLSRIRTSFKH
NTDGPESKV
Download sequence
Identical sequences E0VX09
vb|PHUM492460-PA|EEB17915.1|Rho-type 121224.XP_002430653 XP_002430653.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]