SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM494780-PA|EEB17950.1|golgi-specific from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM494780-PA|EEB17950.1|golgi-specific
Domain Number 1 Region: 640-838
Classification Level Classification E-value
Superfamily Sec7 domain 3.27e-67
Family Sec7 domain 0.0000156
Further Details:      
 
Domain Number 2 Region: 131-230,411-604
Classification Level Classification E-value
Superfamily ARM repeat 0.0000748
Family Pumilio repeat 0.083
Further Details:      
 
Weak hits

Sequence:  vb|PHUM494780-PA|EEB17950.1|golgi-specific
Domain Number - Region: 899-1002,1111-1214,1469-1596
Classification Level Classification E-value
Superfamily ARM repeat 0.0288
Family PBS lyase HEAT-like repeat 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM494780-PA|EEB17950.1|golgi-specific
Sequence length 1993
Comment brefeldin A-resistance guanine nucleotide exchange factor, putative|DS235829.1:33666:41459:-1|gene:PHUM494780
Sequence
MPCTANGLYVVQGEMAILLAAMRKENRWPSHTMQDLSQNVLIQSFNDLKDVLNQIGDLKD
LDPNHYFDPFLEVIRAGETTGPVTSLALSSVHKFLSYGLIEPSNKSVPSTLENIADAVTH
AKFVSIDENSDGVVLMKILQVLRTLVLSPLGHMLTNESMCDIMLGCFRICFEHRLTEHLR
KSAEFCLKDLVQHLFSQLSEFTDDSRNLNQVKKFKMINGAVDSLTSKRKRKSKLNQNKIT
KESKSLQMKTEESKGINKKNTEKILDMQGEIHQESVTKDSEISEPVDSESVQLQDDVNSK
DVENTVTNMDEPLENNSSCIINVENSDNLPSPIVETALDAVDKNASFTVDTCTSLSNSST
RGIEKLDKTGDPQLSSQDYVNPQGVRFTSEISELENENQGKLLPYGLGCIRELFRFLISL
CNPLDKQNNKMMIHSGLTLLGVAFEIGADAIGKHESLLVMVKDELCRNLFSLLHEKKIYI
FALNVQVLFLLFESLRTHLKFQLEFYLIKLTEMIVSDSPKISYDHREIALESVVQLWRIP
GLVTELYLNYDCDLYCPNLFEDLTKLLSKNAFPVDDVYNTHLLSLAALLTIVDSIECHCH
NRIVYEKQMENSNSNSDDLKRVCNVKIGRQKISKNIPSHEELMAIKRKKKLLTSGTEQFN
AKFKKGIEFLQEHHLLSTPLEPQEVVHFLRENPRLDKKMIGDFISNRSNLEILNAFVRQV
SFDFSDLRIDEALRLYLETFRLPGESPLISLIMEHFAEHWHKCNGEPFVNADAAFTLAYA
VIMLNVDQHNHNVKRQNNPMTAEEFKKNLRRVNGGEDFDQEMLDEIYNAIKNEEIVMPAE
QTGLVKENYLWKVLLRRGASKDGIYHHAPNGLYDHDLFSLIWSPTIAALSCLFDKSNDIS
VYQKAMLGFRKCATISAHYGMSNDFDNLIVSLCKFTNLINSSDSPESVTIAFGLNLKAQL
VTKTLFDLVRKHGDIMRESWKNILEIVLQLHKCKLLPKSLIEAEDFLEHNKKIILMREEI
PSQKTETGLLSSLYSYIALGAEASSHRAPSMEDQEHMKIARHCIKECKIDQIITESKFLR
MDSLLELIKSLISASHGPGSNQFNEDATVFFLEILVKIVIQNSDRANGIWLNIRDHIYSL
IVGGSACDHYYLTERAVVGLLRLAIRLMRREEMSLVVLQSLRMLLLLKNNILQRISRQIA
YGLYELLKTSAANIHTSTDWTIIFTLLECVGAGAPPPKLVGNNSQNNVNNGAKSDGDLGS
GNEDSGLGNDRGYTSDSEIHLRQKPSPSVSPEMSPNVGGGWILVGNEGDIQPVPSRNAHQ
NNADFEQELMFHDPFALVKCCESLAFLVRDVAHITPFNFEYCVHCIRTFVEASLNGTDKK
KIKKSNSAKDPKSRKKWMKKKEEKIRSPQLSPTSAYDADESDSEEFPSGYHQISIQLLDL
MHTLHTRTAQIFRWWAAENADTNFTSLWFQGWCPLLQGIARLCCDSRKQVRMSAITYLQR
ALLVHDLQTLTADEWESCFNRVLFPLLAKLLELNFLDEPHLEETRVRAATVLSKVFLHHL
TPLLSLPTFTTLWLNILDFMNKYMLVEKSDLLFEAIPESLKNMLLVMDSAQVFVGSDGYL
PLWDVTWERINSFLPGLKEEFFKAQSAIPKPDDIVSPVIKAADEQPVLSSGSPPPPPSPP
PPPSPSSPPPPSSVPPPPPPHPNKTEFSDSGNQSQLLNQISTSRGTSIILQPPSSYAHTF
TTPILNHLGQQLMTTSISGQLPNSSVSLVPTAASSQSQEQKIPLIVPTVVPGVAAKIPKE
FVYSHENFVSISKDGKPSSEERSANRDSDGSNENKVSEIVVPQPVTMTSCLLPPPTSSSS
SSSSSSSTVTQTPDPPLSNVQNFGSRNSSFVPYVNLNNYSSIRSHVPSSEALYIPPTSHI
TAPVQMYSSPGLDQDDRNKSWSFRPSEMMTSPDDSSNSSVLSQYFSQQNQQPDAFDNLLS
KTNLEKQSENNKT
Download sequence
Identical sequences E0VX44
XP_002430688.1.24195 vb|PHUM494780-PA|EEB17950.1|golgi-specific 121224.XP_002430688

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]