SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM496000-PA|EEB17972.1|DNA from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM496000-PA|EEB17972.1|DNA
Domain Number 1 Region: 38-284
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.88e-55
Family DNA replication initiator (cdc21/cdc54) N-terminal domain 0.0019
Further Details:      
 
Domain Number 2 Region: 325-526,570-679
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.2e-39
Family Extended AAA-ATPase domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM496000-PA|EEB17972.1|DNA
Sequence length 827
Comment replication licensing factor MCM3, putative|DS235829.1:328296:332023:1|gene:PHUM496000
Sequence
MQYVAIIPVFIISRLPLKLKMNEDIINDDNQVLIRELQRDYLDFLDDEQESGKYYERTKA
MIEDKDRRIIINVNDLRKKNPNRCRGLLNNCFIELAAFQRAVKEYVANIDPAYAKEYEDF
FIGFEGNFGSKHVTPRTLTSQFLGNLICVEGIVSKCSFSKLKIVRSVHYCPTTGKFLERK
YTDLTSTEAYPSSAVYPTKDEDGNLLETEYGLSCYKDHQTLTIQEMPEKAPAGQLPRSVD
VICDNDLVDAAKPGDRIRVIGCYRCLPGKHGGFTSGIFRTVVIANSISLITSTSNLILSR
DDMNRFKKLSRRKDIFELLSKSLAPSIHGHDYVKKAVLCLLLGGAEKVLPNGTRLRGDIN
VLLVGDPGVAKSQMLRFVLQTAPRAIPTTGRGSSGVGLTAAVTTDPETNERRLEAGAMVL
ADRGVVCIDEFDKMSDIDRTAIHEVMEQGKVTISKAGIHARLNARCSVLAAANPVYGKYD
QYKTPMENIGLQDSLLSRFDLLFVLLDIVDTEDDKRISDHVVRMHRYRNPNEQDGEVLSM
NTGADLIYTSNDTGKNNENDMFEKYNPLLHGKNRSKKDQILTINFIKKYIIMCKSMKPPI
LSEEASQLISEEYSRLRSQDTLSSDVARTQPITARTLETLIRLSTARAKARFSKTVDAED
AATAIELVQYAIFRKVLDKRDRKKRSRNEDEEEMDVDDDEDNEIRDQRSKRLRSTQEADE
FERLTSQEEQPTPSLAELREQSRITREKGGTSQTTQIDVSNEKLKVFKDTISKIFVATRE
QSLPMHEVMSYLNSQPEPMAKEEIDACFQILSDQNLLMISDNTVYLI
Download sequence
Identical sequences E0VX66
vb|PHUM496000-PA|EEB17972.1|DNA XP_002430710.1.24195 121224.XP_002430710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]