SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM498310-PA|EEB18034.1|tyrosine-protein from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM498310-PA|EEB18034.1|tyrosine-protein
Domain Number 1 Region: 240-522
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.54e-102
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000000129
Further Details:      
 
Domain Number 2 Region: 100-214
Classification Level Classification E-value
Superfamily SH2 domain 1.88e-32
Family SH2 domain 0.00000977
Further Details:      
 
Domain Number 3 Region: 10-112
Classification Level Classification E-value
Superfamily SH2 domain 4.31e-28
Family SH2 domain 0.00000243
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM498310-PA|EEB18034.1|tyrosine-protein
Sequence length 622
Comment phosphatase corkscrew, putative|DS235830.1:398004:421693:1|gene:PHUM498310
Sequence
MIIIIHHLVGWFHPNISGVEAETVLLERGFDGSFLARPSRANPGDFTLSVRRNGEVTHIK
IQNTGDFYDLYGGEKFATLSELVQYYVENQGQVREKNGQVIELKYPLNCADPTPERWFHG
HISGKEAEKMILEKGKNGSFLVRESQSEPGHFVLSVRTEDRVTHVKIRCQENKYDVGGGE
RFESLSELIEYYKKNPMVETSGTVVHLKQPFNATRINASGIDTRVKELQKENGAATGKAG
FWEEFESLQQQECRHLFTRKQGQRPENRNKNRYKNILPFDHTRVKLKNADPNIPGSEYIN
ANYIRQEPQEGSGLAGSEVGLKSYIATQGCLPSTVADLWMMVWQENVRVIVMTTKEIERG
KNKCARYWPDKNQSKEYGPIKVCSVSETSTSDYTLRQFLVSSEEGTEQKTIYHYHFQAWP
DHGVPSDPGCVLNFLHDVNARQESIPDAGPVLVHCSAGIGRTGTFIVIDMILDMIKRQGP
DCEIDIQRTIQMVRSQRSGMVQTEAQYKFVYLAVQHYINTLTQRIQAEQKSLQLGREYTN
IKYTECKVNDGGGSGGSSCGGSKTQIDLPRPPEDLPRQMYENLPLKERGHNNVGASPGPT
AGTRSPTSATSPPTPAPRNCIY
Download sequence
Identical sequences E0VXC8
XP_002430772.1.24195 121224.XP_002430772 vb|PHUM498310-PA|EEB18034.1|tyrosine-protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]