SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM500510-PA|EEB18075.1|hypothetical from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM500510-PA|EEB18075.1|hypothetical
Domain Number 1 Region: 463-592
Classification Level Classification E-value
Superfamily SH2 domain 6.19e-23
Family SH2 domain 0.00071
Further Details:      
 
Domain Number 2 Region: 582-622
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000000000353
Family SOCS box-like 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM500510-PA|EEB18075.1|hypothetical
Sequence length 653
Comment protein Phum_PHUM500510|DS235832.1:115946:118177:1|gene:PHUM500510
Sequence
MNKICKTKNGSKLDGWIESDGLKYIRLDPPVEFQDNPIEKFIEKFAVDFISKLISEAFMI
SCKITWSIPCSQVCHMSDSLSVHSGILWNSFRLCWTPEVLFNGQNENALPTCLSTSLNSL
STTSSDNIDVSNKMKLSVSHGKLRGKQILDVYNVPFDSDIYAVPVDVVQNKKLNSCDKEN
ESIHECGYSIDSGSDEYIVSVASSDDTSSSRNKMKSKAEITTNNVIRQPRCITASSCSTT
EPIHVTVDEVHQYLKTLYANSNDVIENKNFQQFSRHFKTPFKSLHNSTLNNEENIINSLK
TRNNNKYVIEEEENKKMKENLETSTKILSKLESKEKLKKWSSCRPNFSYNIKETLCNIFR
FKKIPSPDQCLGRKEINYRSDEVGIRLSGYEDRNPPSPITKPPFSKRALPPLPGVEDDDG
EKMALTTDSTPLSPQENKTSNNTSLPFKSKESFASVDFASSIEKVKDCGWYWGPISGKVA
EKILSNEPDGSFIVRDSSDDYYIFSLTFKLNSIIRHVRIEHDHGNFSFGSSTRFKSHTIV
DFIESAVEHSRSGRYLFFLHRRPVLGPMRVQLLHPVSRFKQVQSLQHMCRFVILKSVRKD
HIKYLPLPNKVLDYLSTQHYYSENFLTDDLSSDTFKDNNNQFWPFENPTEGFS
Download sequence
Identical sequences E0VXG9
121224.XP_002430813 vb|PHUM500510-PA|EEB18075.1|hypothetical XP_002430813.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]