SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM500920-PA|EEB18086.1|Ral from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM500920-PA|EEB18086.1|Ral
Domain Number 1 Region: 133-398
Classification Level Classification E-value
Superfamily Ras GEF 6.41e-82
Family Ras GEF 0.0000505
Further Details:      
 
Domain Number 2 Region: 540-663
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000129
Family Pleckstrin-homology domain (PH domain) 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM500920-PA|EEB18086.1|Ral
Sequence length 672
Comment guanine nucleotide exchange factor, putative|DS235832.1:182441:186902:1|gene:PHUM500920
Sequence
MHYAEMPQDVSCDSLSAYRAVEKTYQNGDCSELRLELQLPEDAYVKKKGFNKTVEKSPEK
GNAFHAAKNIVTRHSFRNGENGSNFQSGENRKKISAPAVFCGYSKVNFDDEKSPVPSRSK
SQSLPTSALGIDSYDLIVTDILRVSPEDFATQITLLDLPAFRGITLEELQGCGWNKKNKL
VVAPNVVAFTRRFNHISFWTVQEVLNASALKRRTEVLVHFIKIAKKLYELNNLHSLFAIL
SALQCASIYRLSKTWSHISKKDKQSFDKLLDVFADANNWQNLREHLDSLKLPCIPYLGLF
LTDLVYIDMAHPQSGGLESEQRRIKMNNVLRVISNFQESNYNHLNPIPHVQRYLNSIRYI
EELQKFVEDDQYKLSLRLEPPSSAPSSSSSKESVSETVASLNLSPAKGGLSSGSLRLQAA
LTNGNKFVPGHRKCRSLGTKFRSTSLPRNLYNHMLGGCHQSRSHGAMGANKQTNGRDIFN
KCVQVTPCEQDRMYTIPRHLLDDSVLEEQQQCTNLRLNDSMIKNGGDGSTLTINSDELSD
ELSNDCLMQGCLRRKTILKDGKKPGVTSWQRYWVQLWGSSLVFFSPKGFKGTERHDFKKE
PCKMMAISGWTVCPTENPLQPDLFQIADLQRGNVYKFRSGNKSTAFQWCKQLTRISAGVE
EKPLPVNLMSFE
Download sequence
Identical sequences E0VXI0
121224.XP_002430824 vb|PHUM500920-PA|EEB18086.1|Ral XP_002430824.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]