SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM501210-PA|EEB18104.1|JNK-interacting from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM501210-PA|EEB18104.1|JNK-interacting
Domain Number 1 Region: 267-398
Classification Level Classification E-value
Superfamily PH domain-like 9.29e-32
Family Phosphotyrosine-binding domain (PTB) 0.0028
Further Details:      
 
Domain Number 2 Region: 171-260
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000709
Family SH3-domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM501210-PA|EEB18104.1|JNK-interacting
Sequence length 411
Comment protein, putative|DS235832.1:391965:395097:-1|gene:PHUM501210
Sequence
MADTEFEELNNHQFMPDDVRAKAQMYTYCDVEDTSWGKIVHWRKDENIGNVMGGGGGGGG
GGERRRRKLPEIPIYRKTVVAKPLTLAEELGSILEKTNIEKPNFDIGGQTRPLTILKCHN
YLRDEDSSPDSDKFHSTDVDSGNSTAHSPDCIKSVSPQPPNNHNNHNHNNSTSPNSPSSS
SPIKQNQSSLSSFTNLELLDPTHRGLHKFIRRHHDEVEIEIGDPIYVHKEADDLWCEGVN
LRTGGQGIFPSAYVVDVDYDDFDPSTPKVKRERFILGYLGSVETLYHKGNSVLCQAVKKI
KSKNYAPHSCILEISDTGLRMVDRKKPQRKEIPCHDYFYSLKNVSFCAFHPRDQRYLGFI
TKHPQCDRFACHVFIGNDSTRPVAESVGRAFQRFYQKFIETAYPVEDIYIE
Download sequence
Identical sequences E0VXJ8
XP_002430842.1.24195 vb|PHUM501210-PA|EEB18104.1|JNK-interacting 121224.XP_002430842

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]