SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM503150-PA|EEB18139.1|130 from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM503150-PA|EEB18139.1|130
Domain Number 1 Region: 33-271,311-337
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.36e-66
Family BAR domain 0.00078
Further Details:      
 
Domain Number 2 Region: 551-709
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.8e-46
Family Ankyrin repeat 0.0000457
Further Details:      
 
Domain Number 3 Region: 432-547
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 3.14e-35
Family Pyk2-associated protein beta ARF-GAP domain 0.000037
Further Details:      
 
Domain Number 4 Region: 1069-1130
Classification Level Classification E-value
Superfamily SH3-domain 1.97e-17
Family SH3-domain 0.001
Further Details:      
 
Domain Number 5 Region: 313-415
Classification Level Classification E-value
Superfamily PH domain-like 3.94e-17
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM503150-PA|EEB18139.1|130
Sequence length 1131
Comment kDa phosphatidylinositol 4,5-biphosphate-dependent ARF1 GTPase-activating protein, putative|DS235833.1:440135:449669:1|gene:PHUM503150
Sequence
MPGLILVNEFVDETREDYNSPTTSTFVSRMADCRQTIANLEETLDYDRDGLLKMKKAIKA
IYNSGNAHVDNEMYLSRALDRLGTASLNKDQEPDIAAAFMKFSVVTKELSALMKTLMQNI
NNIVMFPVESLLKGDLRGVKGDLKRPFDKAWKDYETKYAKIEKEKKQQAKEAGLIRTEIT
SAEIAEEMEKERRLFQLQMCEYLLKVNEIKTKKGIELLQHLVEYYHAQTNYFQDGLKTIE
HFGNYVADLSIKLQKIRQKQDEERKQLSELRNVLRSAPGFEKEMTAPGIGTPGTEKSGTG
YSLHQLQGDKHAGLTRSGHLFKKSEGKMRRVWQKRKCRVQAEGFLDIFHADESKPPTRVN
LLTCQIKNVGDDKRCFDLISYNRTYHFQAEDESDQRAWLSVLVNCKDTALRRAFDDSGGK
TNESSSLWELQQAIIRLVQRLPGNHACCDCNSMNDPTWLSTHFGIIVCIECSGIHRDLGV
HISRIQSLTLDNIGTSQLLLARYMTNQAFNSVMEANLHGPKLTPYSSMEERYEYIRAKYV
DHKFVRRLCRDEHDLLSELEHAVNNKSLHHLLQVYAEGVDLTAELPTSEIGETALHLSIL
REMGDSLHLVDFLVQNMPPAGLDKPTSLVQDNLENSLNTPLHLCAIHDKVECMKLLLRSG
ADPLKKNATNRTSLDIAIDKRHESCEELLRHALQRKKTLFENVNIEWNLSHDEGSTDLSD
DETIVDERNGCITPEKKCRSRPPSFAGGDSPVNHRSRTCESVDVSSGRLTMPPPLPLGRK
PHIGDDVQPVNISVSLKKRAAPLPPVTSLYGSIGSSHSRTPSDPLQNAPPPNISTASYHS
GNMHKRSPSTDSTKQLVGAKLVLPPNEIPPTLKPVDRSGSCTPNLSGIKRPLGPPPPTPS
RLSHGRSNESLSSMSSEVDGTTQLNPVPPPRKLKHDRLRLESYAEETDVGLALPMPSSSQ
PNTPTSASETRGSRNSLLSVSTSSSTNLTSTYPREERIYCNTSDLSPRECSGGSSGGSNN
SKTREPNYVSRDSISQNLLAKSHNYFNKKDDAAKSSEQRTSRSNSNFVMKRVRALYDCEA
DREDELSFKVGDIIIVTNQQTDDDNWIEGALETDPEHTGMFPISFVEKIPD
Download sequence
Identical sequences E0VXN3
XP_002430877.1.24195 121224.XP_002430877 vb|PHUM503150-PA|EEB18139.1|130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]