SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM503230-PA|EEB18147.1|ae-1 from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM503230-PA|EEB18147.1|ae-1
Domain Number 1 Region: 604-643
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000106
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 2 Region: 551-576
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000851
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Weak hits

Sequence:  vb|PHUM503230-PA|EEB18147.1|ae-1
Domain Number - Region: 718-755
Classification Level Classification E-value
Superfamily Chromo domain-like 0.000153
Family Chromo domain 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM503230-PA|EEB18147.1|ae-1
Sequence length 1284
Comment binding protein aebp2, putative|DS235833.1:538968:547664:-1|gene:PHUM503230
Sequence
MVPLIRTPLENGLNSICVTLSGIAVSSSASSGTSDITDPGSPFSTSSDDSTSSPGKCKII
EKRSQSEEKSELSWSEPPTERCRSEEKIWTKTTEGDTQWEKKKKKKPEENEEQKCCNKKT
ENNLIKNASETDFKMAPNVPSASSPCDIWTSIKGNNTANDNTAHFNKSDSKAIIINKRLN
VDDVNESIPSHPPLNNNNNNNNNVVKVPSPILSEIEHDERVIDKNNKKKSRNDNCEGPKV
KKRRSSYDSGKSATKESTDNGGNKIIIIKNGIVKGGSCEKFGVGSVSTKPKNDRSRHQGK
ITEYFKSQIKSLVGSKRDFGLTKKDATGNGSKSKLVSGTENLEEPPLKKIVKVVQEDKQG
APQEVPVFAKPSSKQSPPLHTIMPLTEPSRLFSQLSNLPRAADFLLSKPAETKTLFNKIL
QNHKNRSKLAESYLKCRTVLKPTGKPTPETDGTVQNHAPYDSSSTRNNYNINNINNNNNK
ELDSNLLNVVVVSNVTNNDVISKTVEEEKANAIGSKESNPPILSVPKTIRFPATCHSNRV
DKHRTSRESISCRWNACSVQFDSATGLLEHLQSAHVLTQVSGEKFVCLWVGCKVFDQKSC
SRTWLERHVLSHAGNKPYRCIVDGCGQGFSTQAILERHVNNHFAADVKKALDNSIVHKLF
RRNGKKLRYRRQPWSARMFDFFDSGIMEGLEHRLVKLTKARTGGDITDIPGKSLALTSQV
IARRMTENGKQQFLLKWFPQNILEDEWVYEEELIRKKTVSIPSLSPSVSSSLQETLELVT
RSSLTYRKGRRKNKGVVVVSSSVPTTPEKLENYEEEGSIKDCPPVTEKPVEKKEEKRENN
NKRPDEECKIVKVELEKKVKMAEEPKLPPPNKCTVVKKVKRKTKVKKTMEEGEKKKFDEP
ISLPPVLAARVPVYDDKKNDCLIEEKTTVSLRAKEEGGGGGPHPHGVTGVLPEEMSMVPV
CSTAEEIVPVQTNGIIMDNGAKLIGTPKPEMIVNGPLKLVTSQYIEQPFVQAVMPVQMPV
TYQIPIVKLSQTSGMFFSQVPNYIIPPSPPVFGPPPPPPVSTFRNGFHFSTSGTAVQFQA
SSTTLQQTTNGFMQSTNSSGFQIVQSPAANIQQSVLLTAFQNSGIPNINIKSPTLRLLNC
QPLILNNAKPLTNVSLTVTNVSSVSNPNAASAAAAAAALTVPTLGVPTMESPNKTGQKII
TAATPNSLMQPMKNNPGPMGVAAAAVSMVTSGTTTPKKLTPKKLNILPKPPTTTNLGSKS
GIADGGKSKKQCLQPCGPAPGTTT
Download sequence
Identical sequences E0VXP1
121224.XP_002430885 vb|PHUM503230-PA|EEB18147.1|ae-1 XP_002430885.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]