SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM503990-PA|EEB18173.1|histone from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM503990-PA|EEB18173.1|histone
Domain Number 1 Region: 10-122
Classification Level Classification E-value
Superfamily Histone-fold 8.38e-56
Family Nucleosome core histones 0.00000916
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM503990-PA|EEB18173.1|histone
Sequence length 144
Comment H2B.3, putative|DS235840.1:42012:42665:1|gene:PHUM503990
Sequence
MPPKATGKAVKKAGKAQKNISKGDKKKKRRRKESYAIYIYKVLKQVHPDTGISSKAMSIM
NSFVNDIFERIAAEASRLSHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYT
RSWHLLVIFFYKDDFNQLGFTNDL
Download sequence
Identical sequences E0VXR7
vb|PHUM503990-PA|EEB18173.1|histone XP_002430911.1.24195 121224.XP_002430911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]