SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM504030-PA|EEB18177.1|histone from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM504030-PA|EEB18177.1|histone
Domain Number 1 Region: 3-97
Classification Level Classification E-value
Superfamily Histone-fold 9.88e-45
Family Nucleosome core histones 0.0000168
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM504030-PA|EEB18177.1|histone
Sequence length 145
Comment H2A, putative|DS235840.1:50684:51195:1|gene:PHUM504030
Sequence
MSGRGKGGKVKGKAKSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAA
EVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAAEQTALF
RANNFDTFNKFCSSLIFCFLPLNFV
Download sequence
Identical sequences E0VXS1
XP_002430915.1.24195 vb|PHUM504030-PA|EEB18177.1|histone 121224.XP_002430915

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]