SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM504090-PA|EEB18183.1|Sorting from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM504090-PA|EEB18183.1|Sorting
Domain Number 1 Region: 676-796
Classification Level Classification E-value
Superfamily PX domain 1.02e-18
Family PX domain 0.0024
Further Details:      
 
Domain Number 2 Region: 454-604
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.68e-18
Family Regulator of G-protein signaling, RGS 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM504090-PA|EEB18183.1|Sorting
Sequence length 1057
Comment nexin-13, putative|DS235840.1:70313:75205:1|gene:PHUM504090
Sequence
MLFQIFGWGGVLIALWISTFGLSSIFIGFLFLILFIWGVFQYIFVKNEEDVNNWHVKQNI
YAEKSTDVISPGIKKIINECSNLKVLPKCDNRLTGSQVIDENLHDIISYLIRDYIYLWYD
KVSDNEEFYYHVKNTGQKVIVQVAARIKDVDWIPYLTTRLVDDAASHLRLYRQACAKTKQ
KQKEIIEAKQKLANEITKPQSLQSFKTTTEQNTASEQKQSHFRNPSGSNIQYNHSRNNSN
SGINFSSKSPPGSGSGGGDSGKIKNHNNDSDSSVLDLEGVFFDLELAMEKHILCRDTICI
DKEQEKLFLQSLMDVLLLLFLPPDDFHCLSFRLLLRDLLVGGVVLPLFTLITDPDYINLC
IIWLCRDFALTPDAFLQTLRTSDSVGELEATKELLAKEIAHLRSRDSGGNDDNFVKQQLS
SLLYVNKVLDNRLKRLQEGLDTDSLAECLLTQSSKLVTLTLDFILKNNVALSYFIDYMTS
TKEQNYIFLYLNVEGWKLSVRKLLDGLNIKKTNNDDEIYLSGGENMKETAISICDQYLME
SANSKIIIEERLLKNLTQRINTETISDDWFDDILNYIYCKLQTNEKFLPGFYKSSNYIKL
LSELELLKDSILVEDNDDDSSSLDNISLSDTTSLHSLDNADLNDQMANTSSDENYENVAV
VVEKTKDVNSIQKKGKFTLAAEIIDTGVVQDRGKTYGIYALYVCKIYEYGFVDKWHVYRR
YSDFYDLQQKVKDSYATLGKLTFPGKKTFHNMERATLEKRMKMLNGYLQVLLQSVEVSDK
YPKLLSMLVSFLEPGEYDKCTGPFAKTFDTLVNPLKTSMRTVGQAVRTMPDNFLNTVDEV
FDGITKVFQLKNKNFDDPMKVGSFLHQETDDNIPLRIMLLLMDEVFDLKSRNQWLRRRIV
TILRQIVRTMFGDIVNKKIVEFVAVLTCPEQVSSYLDTLKQSIWPNGHRAVPTTRDESTK
LRTRVMAKTALLSSLSDELKHIIGSDTTRRGLIKIFHLFQHPVLNRRILYVLMEGILETF
FPQHNIIDIFHKIHSKFEIFFFFFFVPGLRELGNNQN
Download sequence
Identical sequences E0VXS7
121224.XP_002430921 vb|PHUM504090-PA|EEB18183.1|Sorting XP_002430921.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]