SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM504340-PA|EEB18198.1|Growth from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM504340-PA|EEB18198.1|Growth
Domain Number 1 Region: 41-135
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.45e-19
Family Ras-binding domain, RBD 0.0028
Further Details:      
 
Domain Number 2 Region: 373-472
Classification Level Classification E-value
Superfamily SH2 domain 1.07e-17
Family SH2 domain 0.00012
Further Details:      
 
Domain Number 3 Region: 178-295
Classification Level Classification E-value
Superfamily PH domain-like 0.000000173
Family Pleckstrin-homology domain (PH domain) 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM504340-PA|EEB18198.1|Growth
Sequence length 494
Comment factor receptor-bound protein, putative|DS235840.1:126242:142525:-1|gene:PHUM504340
Sequence
MKCSCMDSSASYERLPNVPTYFELTSMFGRDSEDKDRSTEKQEELIFYNDDNSYQTVIVE
KNLCVSDLCQLLALKNRVAKDVNWTIIEHWTDLGLERSLEDHEDVLSTYHNMESFARKTG
KRFVFRKNFIKYEFFPNPQVRDERRQNDDRVQIFNMAGKTKCRTILSSGGECPTVFSHIW
IREANKQVWAKCFLLLKDKKLYLSYKVNSELEKENGQLELFADLSEYHVYTTLNAKNQLR
APTEFGICLRPTNSSSSTPPTLKCLACESERARLCWITAMRLAKYGKQLRENYRSFKNKQ
LENTSPKEYNSFESVRSRVAMDFTGSVGRIVEDPQEAKAIALAEGYCWKKRWRPIARHPT
GKIVHIQGIEAGVHVMQPWFHSGMTREQATSLVAKHGTVDGDSQSSPGAFVLTLKFGAKV
LHKEITPMSSSHQDTICYTLDNGQTKFYDLLQLIEFYQLNTGSLPTRLTHYLVQSPTGVL
YKEKSRIRDTPGSY
Download sequence
Identical sequences E0VXU2
XP_002430936.1.24195 121224.XP_002430936 vb|PHUM504340-PA|EEB18198.1|Growth

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]