SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM506090-PA|EEB18224.1|E3 from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM506090-PA|EEB18224.1|E3
Domain Number 1 Region: 511-561
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000283
Family RING finger domain, C3HC4 0.025
Further Details:      
 
Weak hits

Sequence:  vb|PHUM506090-PA|EEB18224.1|E3
Domain Number - Region: 362-437
Classification Level Classification E-value
Superfamily RING/U-box 0.00459
Family RING finger domain, C3HC4 0.018
Further Details:      
 
Domain Number - Region: 448-502
Classification Level Classification E-value
Superfamily RING/U-box 0.0208
Family RING finger domain, C3HC4 0.085
Further Details:      
 
Domain Number - Region: 232-316
Classification Level Classification E-value
Superfamily Sec7 domain 0.0942
Family Sec7 domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM506090-PA|EEB18224.1|E3
Sequence length 569
Comment ubiquitin ligase triad3, putative|DS235841.1:265381:269000:-1|gene:PHUM506090
Sequence
MKRKSDLRNLIDTDVNLSKYLSQGAIPKNKGHENKNKFSSNESTKSSEKNSQFSRNKENH
HSRIKKWSSLSNFDKRSNDHPIILNSKPNRGPFVYIVPNNPSSGYSLAPGKYLIISLSET
DILNTYSVIRHPKKGARGTSPPETNNSKLNLNSSIEEEYDPLPSNNLNLSTKGEGLKEGE
KKFDELIDKYINDENGLNDYIKLEKITGEILEMMASISLNLPENYLNSLKMKYMELNENK
ELMLKYLEKIKIKMEKEELLLKVLDIFPNIDPSYVKEKLENFNYGGGEKYPINEDLSNDE
NKKLWKMYVNDFDMDDFMIEFPNYKNYYGSIAVLISYHKEINDYERGKKKREDEEREEAE
STGFFYCTLCCDDKLIFSLITICPDGLIICVIMKFTYINIKIGDGANKFYCPCGSDTILP
DDLIKNYLCKRIFKKLLLKRQAEEIKKAQINGLESCLFCHFSYIPNPDDKVFICQNEECL
KEICRNCHEENHIPLKCEEVIREKDIEARKKIEEEMTKKLLRTCPNCGQKFIKIDGCNKI
TCTCGTLACYICQKQIQDYTHFSDRGGIG
Download sequence
Identical sequences E0VXW8
vb|PHUM506090-PA|EEB18224.1|E3 121224.XP_002430962 XP_002430962.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]