SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM506570-PA|EEB18243.1|tyrosine-protein from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM506570-PA|EEB18243.1|tyrosine-protein
Domain Number 1 Region: 471-734
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.21e-76
Family Protein kinases, catalytic subunit 0.000000722
Further Details:      
 
Domain Number 2 Region: 92-285
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.33e-39
Family Ankyrin repeat 0.00018
Further Details:      
 
Domain Number 3 Region: 268-376
Classification Level Classification E-value
Superfamily SH2 domain 4.01e-30
Family SH2 domain 0.00053
Further Details:      
 
Domain Number 4 Region: 7-109
Classification Level Classification E-value
Superfamily SH2 domain 1.32e-26
Family SH2 domain 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM506570-PA|EEB18243.1|tyrosine-protein
Sequence length 751
Comment kinase shark, putative|DS235842.1:199001:202257:1|gene:PHUM506570
Sequence
MSREECISWFHGKLSRDDAEKLIQDLNSEGGFLVRESFASPGDFVLTLLHNGDIVHYQIL
RHGEDAFFSIDNEHIFHGLETLINYHQENENGLITKLTNFCKKDPPPHDTRCHGKTNLLH
RATKEGNYTVVSELLKCGYRNTDAKSEDGQTAAHLASRKGADDILIKLIETGANINCRDT
AGYTPLHYACQSNHLTTIRLLIQKGEAQVQSRNANTGWVPLHEAAWRGLSEVIQLLLGLN
APAHPRTLEGETPLMLAQRKGFQDCVEILRKYKAPKPVLSKYNWYHGTLDRKEAVELLKE
YGNKEGSYLVRYSHKNGGVYVLTMIVNDRSFHFQIKNENGYYFIDDGPLLESLEHVIDYY
SRMQDGLPTVLQIPVPPKPKPPVPEFPRHGLSATMPLKKKNHQRDVGNSLTVDAESNATT
MTRRSSTPLIISTGTGDKSTNKKVVTNNCTQVPQVLLKGEEIVSEPPGCIQSCRLKLGNV
LGEGEYGFVYKGTYQVDDFKTIDVAVKTLHNEHLPVNRCEFIREAKVMTSLNHHCVVKLI
GLSQGPPLMMVQELVPLGSMLAYLIEFPDRVNPNYELKLWASQIACGMKYLEEQRFVHRD
LAARNILLSSRHQAKISDFGLSRVISSDSQYYKATVGGRWPIKWYAPESFNFGTFSHASD
VWSFGITLWEMFSFGQQPYGDMKGSEVIKRVEEGERLSKPENCPEEVYKIMEQCWNFEPT
MRPTFAQLLNIFSTDPEYINIRELVIGSDIS
Download sequence
Identical sequences E0VXY7
XP_002430981.1.24195 vb|PHUM506570-PA|EEB18243.1|tyrosine-protein 121224.XP_002430981

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]