SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM507150-PA|EEB18261.1|transcription from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM507150-PA|EEB18261.1|transcription
Domain Number 1 Region: 154-226
Classification Level Classification E-value
Superfamily Histone-fold 5.03e-19
Family TBP-associated factors, TAFs 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM507150-PA|EEB18261.1|transcription
Sequence length 260
Comment initiation factor TFIID subunit, putative|DS235842.1:423591:425294:1|gene:PHUM507150
Sequence
MEYKDDKFKKKRRKNNERFAAVICGHWNFNSNKGIAIKAAAACLIYLYKIEAYSKEFSAF
LERRHVVSNIENLGQSSQRTTTTTHTAITEPGTQMSHVVNAEHASPAPNLGTLSSVVMHS
PLTTALAGGNNSSSLSPSPTTQSVQSKSTEGHSQILTRPRLQDLVREVDATEQLDDEVEE
LLLQLADDFVESTVNAACVFAKHRHANTVDIKDVQLHLERNWNMSIPGFGTDDLRPYKRA
TVTEAHKQRMALIRKTLKKY
Download sequence
Identical sequences E0VY05
121224.XP_002430999 vb|PHUM507150-PA|EEB18261.1|transcription XP_002430999.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]