SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM507390-PA|EEB18276.1|Rho-associated from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM507390-PA|EEB18276.1|Rho-associated
Domain Number 1 Region: 75-397
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.34e-85
Family Protein kinases, catalytic subunit 0.00000203
Further Details:      
 
Domain Number 2 Region: 941-1006
Classification Level Classification E-value
Superfamily G protein-binding domain 0.00000000000392
Family RhoA-binding domain 0.0027
Further Details:      
 
Domain Number 3 Region: 1231-1280
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000015
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.01
Further Details:      
 
Domain Number 4 Region: 1117-1205,1296-1323
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000238
Family Pleckstrin-homology domain (PH domain) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM507390-PA|EEB18276.1|Rho-associated
Sequence length 1368
Comment protein kinase, putative|DS235843.1:159919:165571:1|gene:PHUM507390
Sequence
MEKIKDDDRKRRLLELEDKIQDPRSAVSIDSLLDTVQALISDCDHPCVKRMKNIEAYTNR
YDKLARDICNLRMKTDDYTLIKVIGRGSFGVVQLVRHNSTQKVYAMKLLSKFEMIKRSDS
AFFWEERDIMAHANSEWIVQLHFAFQDTQYLYMVMDYMPGGDLVNLMSNYDVPEKWAKFY
CAEVVLALDAIHSLGFVHRDVKPDNMLLDKYGHLKLADFGTCMRMGSDGLVRSDTAVGTP
DYISPEVLESQGGEGLYGRECDWWSVGVVLYEMLVGDTPFYGDSLVETYSKIMDHKNSLS
FPQDIEISKAAKNLIYGFLTDRTQRLGRSGIDEIKAHPFFKNDQWNFDNLRETVPPVVPE
LSGDDDTSNFEDVEKEDAPEESFPVPKAFAGNHLPFVGFTYSRDYQLLSGKDGYNSIGDT
VDLGLTKLNTSAQKNQLENELEKEKKKVDELCFKIQSLTTQLDAMKTRETEITEETSQLE
KSITLIKHNLKEAQRRADNEADIRRKVEALLAETKKKLEDEQNKRTREMNNNQQTNDKMN
QLEKQVNELQEKLKAESENAAKQRKLVGELIVVKATSEQLQSELQGMLTGLQAQRDSLQK
EVATLQSQLSQERSSRTQASDLTQELEGKLQGLLIDLDLSKEKEEKLSEDNRLLVEKVSL
LEKEIAGITLELKAAHSRYNQEVKAHQETERSRLLTKEEANLEAVKALQAKLNEEKSARQ
KADLHSQDKERQMSMLSVDYRQIQQRLQKLEGEHRQEMEKVKALQANLEQEQQKKTSLAT
ELGLTQSEVAGLKARETQLTGEISLLRQNKKLVEDELHKVKAQRSVDHLQMKELQDQFEA
EQHFSTLYKMQAAETKEELEEKQRNVQELEEERGSLTHQLQLALARADSEALARSVAEET
VAELEKEKTMKELELKDLLVKHRTDQSNKEQTLNVLKDRESELKKQLDQMSKEREEMTRQ
LRHVQEDMKKRTNQDEEVERLNRVLKQEIVLKQQAVNKLAEIMNRKDMNLRAKPKIKVSS
ADLRRKERDCRKLQQELTQEREKYGQMAAKFQKEIQELQSQVIDESQMKVRLQMEVDSKD
SEIEQLQSRLALLSSETASLSSGGAENENDDGYAQESRLEGWLSVPNKQNIRRHGWRKQY
VVVSSKKIIFYNSESDKQNTDPVLVLDLSKVFHVRPVTQGDVIRADAKDIPRIFQLLYAG
EGEARKPEEGGVQTLDHSTLRGEDKPGTAIVKGHEFVQISYHMPTTCEVCPKPLWHMFRP
PPAVECRRCRIKVHKEHLDKKEDAIAPCKLHLDPTSAKDLLLLAHNSDDQKAWVQRLSRK
IQKCGYKANNCVEGSKISPRESTRSTMKPYNIQQRSSTLPANSSANPK
Download sequence
Identical sequences E0VY20
XP_002431014.1.24195 vb|PHUM507390-PA|EEB18276.1|Rho-associated 121224.XP_002431014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]