SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM512110-PA|EEB18358.1|Phosphatidylinositol from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM512110-PA|EEB18358.1|Phosphatidylinositol
Domain Number 1 Region: 311-423
Classification Level Classification E-value
Superfamily SH2 domain 9.56e-28
Family SH2 domain 0.0000089
Further Details:      
 
Domain Number 2 Region: 604-705
Classification Level Classification E-value
Superfamily SH2 domain 2.15e-23
Family SH2 domain 0.0000343
Further Details:      
 
Domain Number 3 Region: 89-275
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.16e-23
Family BCR-homology GTPase activation domain (BH-domain) 0.00075
Further Details:      
 
Domain Number 4 Region: 38-71
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000778
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.014
Further Details:      
 
Weak hits

Sequence:  vb|PHUM512110-PA|EEB18358.1|Phosphatidylinositol
Domain Number - Region: 409-499
Classification Level Classification E-value
Superfamily tRNA-binding arm 0.0445
Family Seryl-tRNA synthetase (SerRS) 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM512110-PA|EEB18358.1|Phosphatidylinositol
Sequence length 726
Comment 3-kinase regulatory subunit alpha, putative|DS235845.1:458051:460258:-1|gene:PHUM512110
Sequence
MSTTPASCLRLDREEDWEGDAFGSLVHCLRDQENFQCEGSCDKCKKYIDGVLREGYLCYD
CGLQAHKACSAPNSLHSSGLEQLTNKHTLFGIGLCSQFDPAERPAPYVVMRLTQELENRA
RNLPFVDISKLYKVCDDDSVKTLKQKLNEDLYGVELSVLKNYLLELPDPVIPVQSYQIFI
EAALCGSDFQCAARLTSLVHELPEHHKLTLRFLLAHCIRLCQLHHACGYKNPQNVFIQVF
CIVLLRPSWEQFNQVVHNLQAHIRILELLLLHGDWGEKLPEFMSAPILPPRKVSRPGPHP
YRDDLELERDRDSAQQQLKDAEWYWGDITREEVNEKLMNTPDGTFLVRNASNKGGEYTLT
LRKGGTNKLIKICHKNGKYGFSEPYKFNSVVELVKFYKTSSLAQYNSTLDIKLLYPVSRF
QQEDEIASSLNIEKVAKKLAEIEAQLQDKSRTFQKLKEDFNKISKEIEVKRGPTMDAFIE
LTNMFKEQQELQERFKKEAQPHEIKSLMVNSELLKQRIKSLEESRELLKENLKQQVAYYK
TLEREMLTVKREMLGLSKQKEQHMKWLLCKGVKQSQIDHFLAPESLTPWGLRELETDENL
KSMPHQNEYLWNLPECSRAQAATLLESKPEGTFLVRPSSSGQYALSIVCNGVINHCIIYQ
TDRGFGFAEPYNIYPSLKQLVLHYANNSLEEHNEELKTTLMYPVFALTNSRDSSKEETTT
QSNART
Download sequence
Identical sequences E0VYA2
XP_002431096.1.24195 121224.XP_002431096 vb|PHUM512110-PA|EEB18358.1|Phosphatidylinositol

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]