SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM513110-PA|EEB18388.1|Docking from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM513110-PA|EEB18388.1|Docking
Domain Number 1 Region: 92-206
Classification Level Classification E-value
Superfamily PH domain-like 2.95e-28
Family Phosphotyrosine-binding domain (PTB) 0.0038
Further Details:      
 
Domain Number 2 Region: 1-79
Classification Level Classification E-value
Superfamily PH domain-like 0.0000164
Family Phosphotyrosine-binding domain (PTB) 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM513110-PA|EEB18388.1|Docking
Sequence length 656
Comment protein, putative|DS235845.1:810686:813866:1|gene:PHUM513110
Sequence
YCHLYKASKYGIERLEFFDNEDEANSCTSGRFITLENCVKIIPDPQKLQPNVVTRTTSYH
FASVEDNEMPEWLSAFQSVAFKEGSNTQSIEEDNELYCPSGEGLFSVELVQSEVSSRCGL
DPGPYTLLLTSSAIQLRDSKEQQLLFTWPYLYIRKYGYRDGKFTFEAGRKCETGEGEFQL
KYSNQQEIYRCLSLKMKSMRKLLGGEIPSSSSIFCSDSSNQFQAALSMEARSRSPLPPSP
NTSTNILDLDLNGSSQFKSVDCLSNGQFNTGPPLKPKATSYNSLFHSSSFESPPLPFKQK
SLISPTSETNSLNSLNAPPYLHPKSSSVSQNSLDKINSRKSPNLFRATLVDIDIHESPES
QGKYAESLVAPPLKPKPMKPPRKNIFISSSQKCANEEESGSKRFYRQKNDSLAKQDSPMS
QQQNCLSNLISTDVSNSTPPYDEVEIRHEAWKTLGVDEMTHTERPFSQIINSSDSSLDYE
ILDNVVDDSKLMKENENDKMAAAATTTNGGSTSKPCQKFMFLPIKPASVSGNYDTLQHFG
STLNKTNGKSGYKQIIINHSNSSPSSPSPTTTITTDTGYSLLENYANSLNHTFHDYDEVD
ERPIETFRMADDSHLGYGVIRKKPENQIQNDLLRLPPKHKVYNNMEYAVITKSKHV
Download sequence
Identical sequences E0VYD2
vb|PHUM513110-PA|EEB18388.1|Docking XP_002431126.1.24195 121224.XP_002431126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]