SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM513170-PA|EEB18394.1|conserved from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM513170-PA|EEB18394.1|conserved
Domain Number 1 Region: 325-469
Classification Level Classification E-value
Superfamily CBS-domain pair 0.00000000000342
Family CBS-domain pair 0.0073
Further Details:      
 
Domain Number 2 Region: 563-612,645-670
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.000000038
Family cAMP-binding domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM513170-PA|EEB18394.1|conserved
Sequence length 834
Comment hypothetical protein|DS235845.1:839571:847872:1|gene:PHUM513170
Sequence
MESLDKRKRAVEDVQIGIYGMRVEGSEGSASFGEDGIVELLAHSTCNIRLFGKGLSQNLQ
VAFTTTETDDGFCEFPSSEIFRVVEGSKTNYSVVVKIRVPSRPANNAPYYLCIKTGSPTN
SSTGSQKKLWHHQGSDEWLQFRVYERLLPVWMTIVILISLLFFSALFSGLTLGLMSMDKT
DLKILCTTGTELERQYASAIMPVRSHGSLLLCSLLLGNVLVNSVLTILMDDLTSGLIAVV
FSTLAIVIFGEIMPQAICSRHGLAIGAKTIYITKFVILLTCVVAFPISKILDYMLGEEIG
NVYNRERLKELVKTGTDIEKDEVNIISGALELRKKNVAEVMTKLEDVYMLDYNAILDFET
VSDIMKSGFSRIPVYEGRRSNIVAMLFIKDLAFIDPDDNTPLKQLCDFYQNQCYFVFEDL
TLDVLFKHFKEGNKGHMAFVTRVNAEGEGDPFYEVIGLVTLEDVIEELIQAEIIDETDVF
TDNKSKRKREKKHMKQDFTTFCERRENQKIHISPQLTLATFQYLSTMDAFKPDVISETIL
KRLLKQDVMYHIKVKNREKGKTDPSTIIYQQGKPVDYFVLILEGRVEVTIGREEMKFESG
PFTYFGTQALTQNYGVGGDSPTAVIPTSNTGSLQSVNLDNASRQTFVADYTVRAITEVFY
IKIKRSLYLAAKRATLMENSQKTDDHFDDEVDKLLHSLDEDDKSQGQTSQDSPILNNRNH
THGSTDKESLQRCNSSLTESPKSPAGNPGIRPDSPHEPNGTPVRTPLSPVKNKLEDNALM
KMFSEKQQQQQQQNQQQQQQQHVEGEGKEKKNQGDDPSLEERTNLLRPQSDEIS
Download sequence
Identical sequences E0VYD8
XP_002431132.1.24195 121224.XP_002431132 vb|PHUM513170-PA|EEB18394.1|conserved

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]