SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM514160-PA|EEB18433.1|conserved from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM514160-PA|EEB18433.1|conserved
Domain Number 1 Region: 19-151
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000232
Family Pleckstrin-homology domain (PH domain) 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM514160-PA|EEB18433.1|conserved
Sequence length 870
Comment hypothetical protein|DS235845.1:1146109:1148799:1|gene:PHUM514160
Sequence
MDNNTQRNAVIEPSVAPSSSNSMPNVLFREIHKNAFLKRHLSDRRTGFPRKSERVWVVFC
VHDDVEPFLEIYSDQKVALTHKPEWFASLSSALHVSPTICGHEDEFEFAVTLSFQVVRLA
APSWESMMEWVETIRNKLRELKVLCPKENVYSKMPEQKQPLLPTRDPNSPLPLPPEGPSA
LLPGVELVHVESRNNSTSFENNVNVSRHHQREIHLRGNGVNDRQVNRKKSNERDKRLGME
LMTRGSENQSSSSRINNETTFQDGDRETNESNEVFPNVSELQRNKPRVRRAVSVPEPKPS
TSQVAMGSNVTVIEVSSNNGKENHCFPDGGNAVICNTVNTSDDEDTDEEEVHYEHVFLAS
GPSGGKSSQQTKFNSKCVVVGKNKMSKPHSTSVIINSNTTALVNSSPNGTDPTAGSSNKS
AVSAGSSEVQVNNVTSTCINLNATELNIPLPPPPHSTKLENMSVSGLIPRVPPKVSTKQG
IFKPSVIPSNVILESQSCSIQNGNSESVNCGEQNGGTKLTIVENENNNNNNNNNNVSGPS
YSQVKKIQKVKVKCDEMRNPMVKTNSPILEKKIVSEIQIVESDPPSSSNHNQFAEIPSKN
QISISNSKVSNKIEISKKCSGGCSGSGSGSSSSSSSSSSGSGSNSTSKNLGLVNVTVSQD
VASNSKRNPCCSNGDYKIKISNPSTASTSPGNPLDNCKIFSNKGEPQQNHNNNTETEPLM
ASVQPAVGMISVEDIPLIGGHQRRRRRSSSSDAPPPINLPPSRVTGGADRIRINVPLTSN
HSTVREECRGENEIRSSSSSSSSNHPRNSTEPLMVHVNIEPQSSARLTLREQQVLQLKKE
MLHPGGVRLQLRRKDCTGSIALVDALNGVW
Download sequence
Identical sequences E0VYH7
vb|PHUM514160-PA|EEB18433.1|conserved XP_002431171.1.24195 121224.XP_002431171

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]