SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM517340-PA|EEB18521.1|conserved from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM517340-PA|EEB18521.1|conserved
Domain Number 1 Region: 801-1091
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.06e-79
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000407
Further Details:      
 
Domain Number 2 Region: 105-215
Classification Level Classification E-value
Superfamily Second domain of FERM 1.44e-26
Family Second domain of FERM 0.00052
Further Details:      
 
Domain Number 3 Region: 213-334
Classification Level Classification E-value
Superfamily PH domain-like 1.14e-23
Family Third domain of FERM 0.006
Further Details:      
 
Domain Number 4 Region: 18-103
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.78e-18
Family First domain of FERM 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM517340-PA|EEB18521.1|conserved
Sequence length 1096
Comment hypothetical protein|DS235846.1:171820:176701:1|gene:PHUM517340
Sequence
MPFKLHLKKSRHYNVISKSLFVICVELLDGTTIECSLSAESLGSECMEYVCQRLGLQQHE
FFGLCYTSRHGICKWVEMDRPLKRQLDKYGRDQSLYLRVMYYVNNVSLIQDETTRYHYFL
QIKKDVIEGRIQCRVEEAVLLATFAMQAEFGNHDHERHTAEYLKDFVVFPQHIIEHAHHL
DLYEAVVQQHAGLAGLPQGVAKERYILVAKQLDGYGQETFLARDEQRNPALVGVSLNGII
VGQENNTCTKFYQWKDISNVINHKKQFIIECQCPEDNVQFEFGDPELAKYVWKLCVLQHT
FCMQNDQSSENAINRPERNPLQTSNDHVQFNNLFKQTAESRLVDSLNDLGRNDHMFRSSS
LTPGVGQRAQSTSYLDLSSQPDADRLRSLLPSYRPAPDYETAIQHKYIRQAANISRSNPQ
VGLLYSSQPEIHQTHIHENVGGYCYPDVTQVKRMYVDDDQQRMVKANHGPPGMTIHTYST
PDLDNLESRLLAGFQLLQLYKAPPPYRDPLARPNSNSTPDLASQTFGPLRMAFNKPQVSG
SSPDLVSSRTLSARNFSHPYLEQLHPNSEAHRTYTNLANIEGPTLMYQKGISPNPVAAYR
ITAKTLKENTEPIYENIPLPWREDSELRSRTSSIQSAPEIITDKDQGQQQKLQQTQQQQQ
QQQMQQLPTLQQQHQTTNGKIIIKDNQSENNDVKQKNNLNLSQTTTTTTTNQTNTILLNS
STNSTNTNSDLNKTDISLYSTEKSTTSTETTSSKGKSWKRWGGILGKGKSNTLQKSRNKN
ENNASREQPYRWSTGLRWLPIIPTASKETLCQCLEKKLSDPQIFYEFDKIPKMKRNPDFI
TALHPDNVDKNRFKDVLPYEENRVRLTPTKDNKMGYINASHITATVGNSQRFYVAAQGPL
SSTVDTFWQAVWEVDAYLVVRLTSKEEEDCFTYLPASSDHCLQLGEYQIWKEFSQETGHC
LTSRLRVQHTTARRSRSIWHLQYTDWGDQGCPSSPSHFLGFLEELNSVRLHTIEDVPAGH
NRNPPVLVHCSDGVGRTGVTILCDLVLYTLDHNQEVDVPRVVALLRHQRMLMVQNVAQYH
FTFNLLLTYLKQSRLI
Download sequence
Identical sequences E0VYR5
vb|PHUM517340-PA|EEB18521.1|conserved 121224.XP_002431259 XP_002431259.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]