SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM521120-PA|EEB18576.1|Ran-binding from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM521120-PA|EEB18576.1|Ran-binding
Domain Number 1 Region: 279-402
Classification Level Classification E-value
Superfamily PH domain-like 4.92e-28
Family Ran-binding domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM521120-PA|EEB18576.1|Ran-binding
Sequence length 465
Comment protein, putative|DS235848.1:284114:286077:1|gene:PHUM521120
Sequence
MADNNCSSSSALTPIIITSSEQDKPDTSNTDSLVKSCDTKKIEEKISPNDEKESVGNQES
KHTSLFSETLASNSSDKKNGVKINVEKNVMENSTSFLRPSKLTNSFSSSANNTNSNNSTL
PFSLNCPKLNLSESKFGDNTFTNSVVSNTVESPTVNASNNKNNDTKETPSKPSLGLFSSI
LNSNKNNANTQSSVITVPNFVFGQNLHERVSDAVKATNVKKDLSEETKSNGTSEMLFSSV
LSSKDVKENLTQDSFNNSKETCTLIENAAKCQEARASKRKYEEVLVTTGEEEEENVLQIN
VKLFAFDNGAWVERGRGILRLNDKKSEGQTSSRIVIRTVGNLRVVMNTKIWSKMSLSRAS
ERSARLTAMDPNGQLKIFLLQASIKDMTSLYSLLEERIKLCEEQNLENESSSPDKKIALE
KNEIINKFPLKDFVVVKIVVLAFRIILEINKNSCKLFEHWKYSDA
Download sequence
Identical sequences E0VYX0
XP_002431314.1.24195 vb|PHUM521120-PA|EEB18576.1|Ran-binding 121224.XP_002431314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]