SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM522550-PA|EEB18609.1|Centaurin-gamma from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM522550-PA|EEB18609.1|Centaurin-gamma
Domain Number 1 Region: 619-725
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.31e-40
Family Pyk2-associated protein beta ARF-GAP domain 0.00038
Further Details:      
 
Domain Number 2 Region: 28-194
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.27e-33
Family G proteins 0.00000276
Further Details:      
 
Domain Number 3 Region: 163-199,235-274,386-454,555-589
Classification Level Classification E-value
Superfamily PH domain-like 9.74e-18
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 
Domain Number 4 Region: 730-824
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000000497
Family Ankyrin repeat 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM522550-PA|EEB18609.1|Centaurin-gamma
Sequence length 859
Comment putative|DS235848.1:625916:630214:1|gene:PHUM522550
Sequence
MCDINCEIIRYLVDSFVNSQEWTLSRGVPDLRLGIVGSLSSGKSALVHRYLTGSYMQEES
PEGGRFKKEILVDGQSYLLLIRDEGGPPELQFTSWVDAVIFVFSLENEASFNAIYNYYTK
MAHYRNSSEIPLILVGTQDAISENNPRVIDDSRARKLASDLKRCSYYETCATYGLNVERV
FQDACQKIVQQRLNNQITSQVPGTPTNSRPSTPNNHFSSMIPIGNVGLRHYSQPSPTNGI
INTSSSSGGSPSTNNTLASASPCHIPHKESMSRQIHALSASSHQLHRHPDIISKADVSLR
NEEKRAGSYATLGISQTHTFTTENNNTKFGQSQNVENTGTSGKDKDLPTPSSTPTTSRKT
RRRSNLFTSSKKGDDKLKNGGELGSGRAIPLKQGLLYKRSSKSLNKEWKKKYVTLCDDGR
LIYYPNLQDYMDNIHGKEISLQYVTVKVPGQKPRGSRSIIPASNGLNDGISNLSLCNYVG
KDKKLGDKSSLSTFDANKDSGSLSLPQQNDDGIPSNNSVFINGADLRIETPNVKKRHRRI
KSSGVKNAECDDPDGYEFFIVSLDNKQWHFEASNSEERDDWVSAIEQQILNSLQGNEISK
SRSRFAIVDSAVLIAVKNKVPGNAYCVDCDAPKPCWASINLGVLMCIECSGIHRNLGSHI
SRVRSLDLDEWPPGPLSLMLAIGNAMANSIWERNTGGQTKPNFSSSREEKERWIRAKYEN
KEFLQSLSYSTPINQQLIDAICRADIKALLIILAHSTPEDVNCTVSGQDLRTPLHLASAM
GNLPVAQLLIWYGANPRTLDHEGRSCLSYAMTASCKSTTDVTNLINLLTDVGATPSDSGT
NRRSSTGRKDLPTFNKVTI
Download sequence
Identical sequences E0VZ03
vb|PHUM522550-PA|EEB18609.1|Centaurin-gamma 121224.XP_002431347 XP_002431347.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]