SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM522820-PA|EEB18616.1|polyrC from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM522820-PA|EEB18616.1|polyrC
Domain Number 1 Region: 95-195
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.07e-23
Family Eukaryotic type KH-domain (KH-domain type I) 0.00095
Further Details:      
 
Domain Number 2 Region: 9-85
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.53e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000478
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM522820-PA|EEB18616.1|polyrC
Sequence length 234
Comment binding protein, putative|DS235848.1:673281:674486:1|gene:PHUM522820
Sequence
MEDRHLLNDDPNITLTIRLIMQGKEVGSIIGKKGEIVKRFREESGAKINISDGSCPERIV
TVTGPTNAIFKAFSLICKKFEEFQELQSGGGSMGIPKPPITLRLIVPASQCGSLIGKGGS
KIKEIREVTGASIQVASEMLPNSTERAVTISGTSEAITQCIYHICCVMLESPPKGATIPY
RPKPQVAGPVILAGGQAYTIQGNYAVPAHDNRALENKIKRFRHLIDEFDSGSEC
Download sequence
Identical sequences E0VZ10
121224.XP_002431354 XP_002431354.1.24195 vb|PHUM522820-PA|EEB18616.1|polyrC

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]