SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM522830-PA|EEB18617.1|heterogeneous from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM522830-PA|EEB18617.1|heterogeneous
Domain Number 1 Region: 45-124
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.19e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM522830-PA|EEB18617.1|heterogeneous
Sequence length 126
Comment nuclear ribonucleoprotein, putative|DS235848.1:674898:676325:1|gene:PHUM522830
Sequence
MRQIGAANPLAGLAALGLPALNTTNTGGLNPAALAALAGSQLRTNNPSRNQQGNSQQTHE
MTVPNELIGCIIGKGGTKIAEIRQLSGAMIRISNSEEREGGNTDRTITIAGNPEAVALAQ
YLINMR
Download sequence
Identical sequences E0VZ11
XP_002431355.1.24195 121224.XP_002431355 vb|PHUM522830-PA|EEB18617.1|heterogeneous

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]