SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM523560-PA|EEB18631.1|smif from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM523560-PA|EEB18631.1|smif
Domain Number 1 Region: 10-121
Classification Level Classification E-value
Superfamily PH domain-like 1.28e-39
Family Dcp1 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM523560-PA|EEB18631.1|smif
Sequence length 404
Comment putative|DS235849.1:12974:14212:-1|gene:PHUM523560
Sequence
MADIPAQAMLNEAALKRFDPYVKEILDTAKFVALYTFNPEENEWEKTNVEGSLFVYSRTV
LNRLNTTNLIEPISHKFDLQLHEPFLLYRNTKFCIYGIWFYEKEECTRLATLIQELMKKL
GGNKRTPSSLNSNGGANVDIFSMLSKAQEVYNSSKSNNNSISKNSNKMVLPQVEQTPQSV
MDFFAKAGSAPQKAAVPAGNSSRLVLGRSQSVRAIDTNDKGPINPLIHQLMSDPVHSVEH
IEKQQRSVTPQTLESNSQLLKKFIRPTSGQLIDIDSQPATDETPKKNSKMENGLNFKMSP
SFQSLFSQPILDAPDLRSLTTPKTPSETPQKPALMPPAMFTPSALKDSFSNESELNFKNT
ESTKPELLTKNQLLQALNYLLKNDPEFVTKIHEAYVKSLTDKVL
Download sequence
Identical sequences E0VZ25
vb|PHUM523560-PA|EEB18631.1|smif 121224.XP_002431369 XP_002431369.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]