SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM523780-PA|EEB18643.1|hypothetical from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM523780-PA|EEB18643.1|hypothetical
Domain Number 1 Region: 15-109
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.0000000000982
Family cAMP-binding domain 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM523780-PA|EEB18643.1|hypothetical
Sequence length 119
Comment protein Phum_PHUM523780|DS235849.1:80981:89559:-1|gene:PHUM523780
Sequence
MKLNKNLSGVFVCLKFFTPFGPNDRTDTDIKAIIDRLRRIESFSRLSNQVLQQLAACGFY
EDLEKGVTHVGSTFGENILDEHPRHATVATQTTCELFRIKNQDFKLVWERKEKKQNGES
Download sequence
Identical sequences E0VZ37
XP_002431381.1.24195 vb|PHUM523780-PA|EEB18643.1|hypothetical 121224.XP_002431381

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]