SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM527200-PA|EEB18673.1|calcium-dependent from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM527200-PA|EEB18673.1|calcium-dependent
Domain Number 1 Region: 505-623
Classification Level Classification E-value
Superfamily PH domain-like 4.66e-23
Family Pleckstrin-homology domain (PH domain) 0.00000471
Further Details:      
 
Domain Number 2 Region: 388-489
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000018
Family Synaptotagmin-like (S variant) 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM527200-PA|EEB18673.1|calcium-dependent
Sequence length 1308
Comment secretion activator, putative|DS235849.1:766145:775710:1|gene:PHUM527200
Sequence
MIDPSSSEEEGDEEQGNHHQTHEPIRSHSHVKQIHSHPTPSQLHTNGASNLEVPGSTSLP
RSVSPVSAVSSETLSVRANSLPRPASPSPSIVSEKNEVDLQDKQERQEEERKRRIQLYVF
ISRCIAYPFNAKQPTDMTRRQMKITRQQLETIQGRFQAFLKGDTQIMADEAFQNAVQSYY
DIFLKSERVAKMVMSGACSQHDFREVFRNNIEKRVRSLPEIDGLIGDDDSKRPSRMQQQS
LNSELILSKEQLYDMFQQILGVKKFEHQLLFNALQLDSADEQAAAIRRELDGRMQKVSEM
EKNRKLMPKFVLKEMESLYIEEVKSSINLLMANLESLPVSKGSLDSKYGLPKLKKYNHRS
QGSLAKLEGDVADTDTQLTKMDVVLTFQLEVVVMEVKGLKSLAPNRIVYCTMEVEGGEKL
QTDQAEASKPMWDTQGDFTTTHPLPAVKVKLYTENVAMLAIEDKELGKVTLKPTPLSSKV
PEWHKMTVPKNLPDQDLRIKIACRMDKPLNMKHCGYLYALGKSVWKKWKKRYYVLVQVSQ
YTFAMCSYKEKKSEPSEMMQLDGYTVDYIEAGSDLEGGRFFFNAVREGDSILFACDDENE
CHLWVMAMYRATGQSHKPTPPITTTAITISKIQGDADRARKHGMEEFISADPCKFDHAAL
FKTLQTLTLDYRLNDPYCSLGWFSPGQVFVLDEYCARYGVRGCYRHLCYLSDLLDRAEKS
IMIDPTLIHFSFAFCASHVHGNRPDGVGTVTHEEKEKFQEIKDRLRILLENQITNFRYCF
PFGRPEGALKATLSLLERVLMKDIVTPILPEEVRGMIKKSLETAALVNYTRLSGEAKIEE
DLNGETMVTPSKKLEDLIHLAELCVDLLQQNEEHYAEAFAWFSDLLVEHAEIFWSLFAVD
MDQVLAEQPPDTWDSFPLFQILNDYLRTDDNLKNGRFHQHLRDTFAPLVVRYVDLMESSI
AQSIHKGFEKERWEIKGNGCATSEDLFWKLDALQSFIRDLHWPDLEFRQHFEQRLKLMAC
DMIESCIQRTDAAFQQWLKKGVTFISTDYIIPSEMCAMVNVILDAKNQSIKLCAVDGVDV
HQYHTKIDDMIEKTSTGMTQGMIAKLMSVLEATLSKLGRYDEGSLIGSILSFTNVSGSGK
DMGQAYVNFTRNCMDQIRSKVNDELWILNFFEQWYMGQIQIICNWLTERIDHSLHLYQCT
CLAVIVKKLYSDFELQGVMEDKLNSKIYQTVSQRMQTEEATCALSMPHGGGDEEKPTVTI
RETLGTGDDANVVSKLTNVTSNVVGKVGNMFEKGIGGLSTKFTGGSWF
Download sequence
Identical sequences E0VZ67
121224.XP_002431411 vb|PHUM527200-PA|EEB18673.1|calcium-dependent XP_002431411.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]