SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM527210-PA|EEB18674.1|protein from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM527210-PA|EEB18674.1|protein
Domain Number 1 Region: 99-297
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 2.01e-20
Family Arylamine N-methyltransferase 0.068
Further Details:      
 
Weak hits

Sequence:  vb|PHUM527210-PA|EEB18674.1|protein
Domain Number - Region: 17-67
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.0366
Family BCR-homology GTPase activation domain (BH-domain) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM527210-PA|EEB18674.1|protein
Sequence length 330
Comment C9orf41, putative|DS235849.1:776306:778166:-1|gene:PHUM527210
Sequence
MGEWEDEEERAYFQSVISAFKYYRTYSLQRIAKSEQYFKSLPDHHQKLMECYLQHLNIIK
NCVEANDYLIKMIIKDADYMFSNVNPVDQNNIQPERKSCYDPIITEILSEFPPDGKKPED
VKILVPGAGLGRLAFEIAKLGYTCQGNEFSLFMLLASQFVLNKCCNTNIHKVYPWVHQFV
NNLKPEHQTQSVSFPDINPRDLSTNSSFTMAAGDFLEVYTEDNVWDCVATCFFIDCANNV
AAFIETIYKILKPGGIWINLGPLLYHFSDVPQEDSIEPSYEVVRQIIVGLGFVIEKEKMD
VSTSYAQNPNSMLQYQYRSVFFICRKCLNV
Download sequence
Identical sequences E0VZ68
121224.XP_002431412 XP_002431412.1.24195 vb|PHUM527210-PA|EEB18674.1|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]