SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM529430-PA|EEB18708.1|KH-domain from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM529430-PA|EEB18708.1|KH-domain
Domain Number 1 Region: 75-198
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.91e-33
Family Eukaryotic type KH-domain (KH-domain type I) 0.000000859
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM529430-PA|EEB18708.1|KH-domain
Sequence length 338
Comment protein, putative|DS235851.1:117157:174230:-1|gene:PHUM529430
Sequence
MCDSNTNATTQSIADYLAQLLKDRKQLAAFPNVFLHVERLIDEEIAKVRASLFQINGTKK
DPLILPEGEGPPTTLTEKVFVPVKDHPDFNFVGRILGPRGMTAKQLEQETGCKIMIRGKG
SMRDKKKEEANRGKQNWEHLNEDLHVLLSVEDTENRAKVKLQRAVEEVKKLLVPADGEDE
LKKRQLMELAIINGTYRDSNAKVAAVAACDEEWRRLAVSAAAETQRLLSPAMPGLGTPLR
SPATPLGAPLIISPRLPVPTTAASLLNGTGTGPLLSPAEHPGLIYTPYADYANYAALATS
PLLTEYASADHTAAAAAKQRRHLGQIREHPYQRANAIS
Download sequence
Identical sequences E0VZA2
XP_002431446.1.24195 vb|PHUM529430-PA|EEB18708.1|KH-domain 121224.XP_002431446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]