SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM538010-PA|EEB18889.1|proto-oncogene from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM538010-PA|EEB18889.1|proto-oncogene
Domain Number 1 Region: 282-554
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.56e-84
Family Protein kinases, catalytic subunit 0.00000000197
Further Details:      
 
Domain Number 2 Region: 146-257,285-311
Classification Level Classification E-value
Superfamily SH2 domain 5.81e-38
Family SH2 domain 0.00000802
Further Details:      
 
Domain Number 3 Region: 112-151
Classification Level Classification E-value
Superfamily SH3-domain 0.0000144
Family SH3-domain 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM538010-PA|EEB18889.1|proto-oncogene
Sequence length 1347
Comment tyrosine-protein kinase abl1, putative|DS235854.1:452121:459299:-1|gene:PHUM538010
Sequence
MGAQHTKDRVVSTSGTVGQGVSSGPLSVRGTKNRFQQQQQQQLQTKNSFKDGKQSGSNIF
TEHNEALLQSRPLPHIPSIPDGSPPSVTGSPLDSAARWTSKENLLCQEEDDPQLFVALYD
FTAGGENQLSLKKGEQIRILSYNKSGEWCEAHSSPGQVGWVPSNYVTPVNSLEKHSWYHG
PISRNAAEYLLSSGINGSFLVRESESSPGQRSISLRYEGRVYHYRINEDSEGKVYVTTES
KFNTLAELVHHHSLHSDGLITQLLYPAPKHNKPTVFALSPEPDEWEINRTDIVMRHKLGG
GQYGDVYEAVWMRYNMTVAVKTLKEDTMALKDFLAEAAIMKEMKHPNLVQLLGVCTREPP
FYIITEFMSKGNLLDYLRTGSKEHINAVALMYMATQIASAMSYLESHSFIHRDLAARNCL
VAENHLVKVADFGLARLMRDDTYTAHAGAKFPIKWTAPEGLAYNIFSTKSDVWAFGILLW
EIATYGMSPYPGVDLTDVYHMLEKGYRMEIPPGCPPKIYELMRQCWQWKPIERPTFREIH
HSLENMFQESSITEEVEKQLQGTVTPQMPCKKSSHNSSVGVKSVNLGSTGNLHGLVQTSD
PLPKEQVNKLSTFTTPTLPVTANKSMVQMRRTTNKRGKQAPAPPKRTSLLSSCSSFRDST
FADQDSGENPSDEHSQECNGNSKEFPNLGSINKGDSESDLQDQTPDTDDSGAHSYPEQPT
QPPMDLSHGSFKRAPIMGNRGLEQIGKKTKTYPPKESGGEKPVQIAALEVQNVKRAINRY
GTLPKGARIGAYLESLRQSGLSTDCCESEIKEVVPLEETPTASSVTEVPQKFSNVQSNMT
RSNSSGGVVGINPSSSSSPNKVSRSRGGVTRNNSTDSAGNLRTFRPNPKHSSNCLKTNSP
SRGNPPNLAEMDFPPPPNDLPPPPSEDSPSSPPPSSNKRPPTSSSSSSPKASKNSTITEV
ESNAQNETNSDFHRSSDSSTPRFGISLRRLENSIDSLGNFKSSDSAVNNDNNLGNSDKPP
EDDKELTSNKIKNSAIKKIKVRTAKNKDSPTDIQKSPSDSKAQTRKFPSKEDNGEVMLKT
QLKKIDPTVVKKTDNGTIVDFKSRLRKVEVEKKSSGECNEDENEVASADEENKRKSTGSI
NSLKKLWENKDGVESVSQISPKLSNKLSKSDDKDSSPHDKKIWPPPLLPSLTSADEKPSV
PAKPIVKSSKPVVPPPAKPSAPSNIYATPSRSDGKNVESPEKNKESVLEISQALENALGL
LKSSGATTTAGWLQLSDKIRLLHGKCQGYVDSLSPPQVKFKYRELLSRLDSLARQLRSAG
TRNSEENILLCNEVQNTIKDVLNSISR
Download sequence
Identical sequences E0VZT3
vb|PHUM538010-PA|EEB18889.1|proto-oncogene 121224.XP_002431627 XP_002431627.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]