SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM546100-PA|EEB19019.1|uxt from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM546100-PA|EEB19019.1|uxt
Domain Number 1 Region: 39-159
Classification Level Classification E-value
Superfamily Prefoldin 8.11e-18
Family Prefoldin 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM546100-PA|EEB19019.1|uxt
Sequence length 163
Comment putative|DS235857.1:80267:80939:1|gene:PHUM546100
Sequence
MFEVNCNNNFVTCHVLLDSRMENVEINEKILRYESFINDVLKEDLKLIHGQLEKKNTDIA
EWVQLKTVLITLNENDMMDGFKTKMDIGTNVFAQVNVADASKILVNVGCNLYVEFTIKEA
LKFTEQTIEYLNKQIKILRTTSAEIKARIKLVLHGIQELSNIK
Download sequence
Identical sequences E0W063
XP_002431757.1.24195 vb|PHUM546100-PA|EEB19019.1|uxt 121224.XP_002431757

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]