SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM546570-PA|EEB19026.1|conserved from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM546570-PA|EEB19026.1|conserved
Domain Number 1 Region: 7-102
Classification Level Classification E-value
Superfamily PH domain-like 2.71e-16
Family Ran-binding domain 0.056
Further Details:      
 
Domain Number 2 Region: 176-448,493-580
Classification Level Classification E-value
Superfamily ARM repeat 0.0000331
Family PBS lyase HEAT-like repeat 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM546570-PA|EEB19026.1|conserved
Sequence length 848
Comment hypothetical protein|DS235857.1:318209:321913:1|gene:PHUM546570
Sequence
MSTDTRRRVKLYALNADRQWDDRGTGHVSSVYVDRLKGVSLLVRAESDGSLLLESKIQPD
TAYQKQQDTLIVWSEGDNFDLALSFQEKGGCDEIWEKICQVQGKDPSVEVTQDIVEESED
ERFDDINDSGNPVELPLCELSRLEEINEVIGSCLSSQNRKEKVAILLENEGYIKKLLNLF
RMCEDIENSQGLHHLYEIFKNIFLLNKNALFEVMFAEDTIFDVVGCLEYDPASPTPKRHR
QYLKQLAKFKEVIPITNAELLAKIHQTYRVQYIQDVVLPAPSVFEDNMLSTLSSFIFFNK
VEIVTLIQEDERFLSELFAQLTDDSTEDVKRRDLVLFLKEFCNFSQNLQPPAKEAFYKTL
SSLGILQALEITLAIDDAQTKTASIDILTYIVEYSPSVVREYTLQQANNTEEDQFLMNVI
IEQMMCDNDPELGGAVQLSGILKILLDPENMLTSTNKSEKTDFLNYFYKHSIHVLIAPLL
LNTSEDKPGKEDHQTVQLLGLILELLSFCVEHHTYHIKNCVLNKDLLRRILVLMKSSHGF
LVLGALRFMRKIVALKDEFYNRYITKGNLFAPVIDAFLRNNGRYNLLDSAVLEMFEFIKV
EDIKTLYSHVVENYGKLLDDVEYVQTFKSLKLRYDQHQDRLKDRDRTTLERNSSICSSVP
SILRNSRYRRDQRQLDEEEEMWFNEDDDAGEVVPFSSEIITKKMDTELDSIGKIIDAKKS
EGTNHTKLINNTRTTGILNNNATGGSPLSPNSNINSNTSDSKTNSLFKKCSVNSVGNQSV
LSKPWLLAGTSASVLSLPKIGFELNVEIPKVLCLSESSGGSVTTTENSRSDASVICPSGF
VQSTDTSI
Download sequence
Identical sequences E0W070
121224.XP_002431764 vb|PHUM546570-PA|EEB19026.1|conserved XP_002431764.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]