SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM547010-PA|EEB19040.1|conserved from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM547010-PA|EEB19040.1|conserved
Domain Number 1 Region: 555-641
Classification Level Classification E-value
Superfamily PH domain-like 2.09e-18
Family Third domain of FERM 0.012
Further Details:      
 
Domain Number 2 Region: 360-452
Classification Level Classification E-value
Superfamily PH domain-like 1.31e-16
Family Pleckstrin-homology domain (PH domain) 0.02
Further Details:      
 
Domain Number 3 Region: 250-303
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000115
Family Second domain of FERM 0.0069
Further Details:      
 
Weak hits

Sequence:  vb|PHUM547010-PA|EEB19040.1|conserved
Domain Number - Region: 516-554
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000602
Family Second domain of FERM 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM547010-PA|EEB19040.1|conserved
Sequence length 664
Comment hypothetical protein|DS235857.1:404420:407128:1|gene:PHUM547010
Sequence
MDWSDHALWWPKKNFWLTRTRSTLDQYGVQADALLHFTPMHKCLRVQLPDLRYLDCKVDF
SIKTFNAVINLCKELGIRHPEELSFCKPLESNHLKHNLKDLNNKRKNHENIQNGQIPSDT
NTFIATEAHNGSNGSLDKNSPYMCAPMTPTKGSVGSPLGSSGTWKRNQSPAFSDSLNGTL
ILPSLLSDTTDGSIESSLANSPTTPNQEARSRLLRPKSLVERARMNVAWLDSSLSIMEQG
VREFDTLNLRFKFYAFYDLNPKCDSVRINQLYEQAKWQLLNEEIDCTEEEVLMFAALQVQ
INIQAGIPQPKMELGNNIADDDIDAALTDLQVSLEGTNISNGCNDITQVPKLYDYLRFLK
PKRFTLKQFKKYWFTCRDLKLTLYKSQEDADNGGEPVHVINLRGCEVTPEVNIAQGKFAI
KLEVASPDGMTEMWIRCDSEEQYAKWMAACRLGAKGRSLADSSYEAEVKNIEAFLKMQHR
APSPAIIQRKGIASALYDAYILFKSILDLFIDTKTTFSFQLIQRILEAHANVKDLNLMDA
KMSYIKAWQSLPEFGISLFVINFMGHKKEELLGVAFNRIMRMDLNGDHLKTWRYNSLIAW
NVNWEVKHMMIQHEEGNIIFSCLSADCKVIHEFIGGYIFLSMRSKEANQTLNEELFHKLT
GGWV
Download sequence
Identical sequences E0W084
XP_002431778.1.24195 vb|PHUM547010-PA|EEB19040.1|conserved 121224.XP_002431778

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]