SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM550210-PA|EEB19091.1|GTP-binding from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM550210-PA|EEB19091.1|GTP-binding
Domain Number 1 Region: 46-224
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.6e-33
Family G proteins 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM550210-PA|EEB19091.1|GTP-binding
Sequence length 274
Comment protein REM, putative|DS235858.1:282049:289585:-1|gene:PHUM550210
Sequence
MVKLIVFSTEHLASNVGTVGSYPGSVRTSAECSLASSRESSTTTVPYKVVMLGSAGVGKS
SLISQFMTSEYLHAYDTSLDEEFGEKSVSVLLDEEESELIFVDHPSAEMSPENCITTYQP
QAYIIVYSVVDRSSFQIAEETLQSLWKTDSIGSKAVILVGNKTDLVRSRTITSDEGKNMA
RSYDCKFIETSVGINHNVDELLVGILTQIRLKIQQATKPKRNKSPLGRCIGKDSDSPKKW
RKSRLTASLKVKGFLGRVWVRDSRSKSCENLHVL
Download sequence
Identical sequences E0W0D5
XP_002431829.1.24195 121224.XP_002431829 vb|PHUM550210-PA|EEB19091.1|GTP-binding

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]