SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM551930-PA|EEB19123.1|protein from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM551930-PA|EEB19123.1|protein
Domain Number 1 Region: 320-611
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.02e-78
Family Protein kinases, catalytic subunit 0.0000000105
Further Details:      
 
Domain Number 2 Region: 912-1050
Classification Level Classification E-value
Superfamily FAT domain of focal adhesion kinase 8.76e-53
Family FAT domain of focal adhesion kinase 0.0000116
Further Details:      
 
Domain Number 3 Region: 47-163
Classification Level Classification E-value
Superfamily Second domain of FERM 1.57e-29
Family Second domain of FERM 0.00015
Further Details:      
 
Domain Number 4 Region: 170-276
Classification Level Classification E-value
Superfamily PH domain-like 2.83e-22
Family Third domain of FERM 0.00027
Further Details:      
 
Domain Number 5 Region: 1-45
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000227
Family First domain of FERM 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM551930-PA|EEB19123.1|protein
Sequence length 1172
Comment tyrosine kinase 2 beta, putative|DS235858.1:500523:506323:1|gene:PHUM551930
Sequence
MRLRNLTSKQTVWLHQDMTMLQVEEKYFKKEPHGWRFELRIRYIPRDWNDVYKGDRVTFC
YYYDQVRSDYFASDCSHLDQDTTIQIGCLMIRNFFKDSSYISLDKKSSFEYLEREIGLYK
FLPRIFIENTKPKTLRKLIQQNYKKVSTLNEFDCTTKLLKIFKIHFKFEEERFQCALGTA
WSVPVEVVISPDVGVSYTTHIGTGAISIADFEKIRGIQTFTSNYDNKEKGIVQLEIQGAT
EILTISCNDINEAESLADLIDKYVSLTTNIFVSIWRRKERHKEEVATTEPTANVSENKYA
PTLTEDYTEIADEEGDYSTPATREYELDRRRIDLLEIIGEGQFGDVFRGSYTEKEGSVIP
VAVKTCKADSDVSTGEKFLEEAYVMQQFEHPHIIKLIGVCSESPIWIVMELARLGEMRAY
LQSNASRLDLATLLLFSFQLSTALSYLESKKFVHRDIAARNVLVSTPHAVKLADFGLSRV
LDNQSYYKSSKGKLPIKWMAPESINFRRFTTASDVWMFGVCIWEILMLGVKPFQGVKNND
IISKLENGERLPLPPNCPPRLYSLMSQCWYYEPSKRPTFKYIRQILNEILMEERNQLQET
MRRENRRVQAMSWGSSGSDEAPPKPSRYPGQESLMISSNASAPQVSTYIVAQNPEVLVQL
LRENERRGINPSVYTTPANAFNTLSVDFDSETSKTTKIDKAEFTTKSLPRPIKMGNLEKT
LAEQCVVSVGGDVADVDADGNDGGGSNTGGGGKSLSCSDFTDLKTDLNEFTLIKRINNSS
NSTIITPYNSQVLDGDTISCKTIVNTESQTQSCSQEKIPVDTAVYGDSHLAKREDFFTPQ
LTEQELLERRLREQQKQSEEDSKWLMEKESNLKKRLSISTSSSDAFSGSPSHQNNVDQKP
VQEKERPIIVKKMDPAPTADLDRTNDQVYDCTTNVVKAVMSLSQGVQASRADDYLDLVRA
VGQQLRNLLSSVDDILKFLPANTHRQVQLAHKVLSKDMSDLVTAMKLAHNYSSTTLDSEY
RRMMLSAAHALAMDAKNLLDVVDSIRIRYPEVSDKLILFFTENNVVVGETSVPYGTNSSN
MGNDDVESSSPSPHPPSSASSISSSSSPFKKQSQPQSQAEGNFSSSSCFSIGKNSIVEQN
HQRQQPQPQQPLYDFSSNVNNSSNDSFTSKNG
Download sequence
Identical sequences E0W0G7
vb|PHUM551930-PA|EEB19123.1|protein XP_002431861.1.24195 121224.XP_002431861

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]