SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM558890-PA|EEB19172.1|conserved from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM558890-PA|EEB19172.1|conserved
Domain Number 1 Region: 2-129
Classification Level Classification E-value
Superfamily PH domain-like 8.97e-55
Family Necap1 N-terminal domain-like 0.00000287
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM558890-PA|EEB19172.1|conserved
Sequence length 243
Comment hypothetical protein|DS235861.1:161720:163281:-1|gene:PHUM558890
Sequence
MESYESVLLVKSEVFVFKIPPRTSNRGYRAADWNLQAPQWTGRMRLVSKGKDCVLKLEDK
VTGELFAKCPIETYPGVAIEAVTDSSRYFVLRIQDDNGRSAFIGVGFSDRSDSFDLNVAL
QDHFKWLKKSEEIEKEKEEPRQELDLRFKEGETIKININVAKKKDGNDNENKSKSKTGKT
GILPPPPGGIKIAPPPSGGCKVTPVGSPVHASSPSVTPSGSQTNPFTDGSSGSSTNANWF
IVP
Download sequence
Identical sequences E0W0L6
vb|PHUM558890-PA|EEB19172.1|conserved XP_002431910.1.24195 121224.XP_002431910

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]