SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM563970-PA|EEB19251.1|conserved from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM563970-PA|EEB19251.1|conserved
Domain Number 1 Region: 659-936
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.4e-65
Family Extended AAA-ATPase domain 0.000000821
Further Details:      
 
Domain Number 2 Region: 219-447
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.8e-59
Family Extended AAA-ATPase domain 0.00000246
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM563970-PA|EEB19251.1|conserved
Sequence length 942
Comment hypothetical protein|DS235862.1:765443:769923:1|gene:PHUM563970
Sequence
MKISGYFSDPLLVPRINQYLSDNKNKLYVDINDMVNELQSQYADYSRKKKSAFKPLVEKA
FSFVLQQCGMNPDDCPKVETFSNSSGNSSSDVEECNTESKPSSNNQMINLYNTPKSQTCA
HEKAELIDLSSDDENVKKKDVTMEKSNTNLSKINNCSNYLIKNKSISCTRIGPEKNDVLD
HVDHPVRHLPMMKRLRPHSPVKPHIKIIKKKKIRMCSPKQVTFADFGGNTKVLEEVCKLI
LHIPHPEIFREIGISPPRGFLLHGPPGCGKTLLATAIAGELDVELIQISAPELIGGVSGE
SEERIRELFDRAVESAPCVLFIDEVDAIMQNRQNAQREMERRIVAQLLTCLDELNTKENG
DLVLVIGATNRPDSLDPALRRAGRFDREVCIGIPDLKAREKILKVLCSTLNLAPNFSFEE
LAQHTPGYVGADLLALTREAAMVAVNSLEELKNKEKKQKNIEKKQEPWKEEVKNDTDELM
DIDVLEGGGGGIDCKKTSNDEKNECQKKNNSQNLNNNDKSDLNVKSQNGGDDIREGTMAN
GENDVKNNKNDNDDDDASMEISVNDVSDGEKNINKVEKEENVNKNTTEETDDIDVEVITD
VTTKPNNSPNLETLMYWIQEFSPLSLGQLKNICLTQEDFKKALKSVQPSAKREGFATVPD
VTWDDVGSLADIREELKMSILGPVKYRKQFEQLGLTAPAGILICGPPGCGKTLLAKAVAN
EAGINFISVKGPELLNMYVGESERAVRRCFQRARSSAPCVIFFDELDSLCPRRSDTPESG
ATMRVVNQLLTEMDGIEDRKEVYIMAATNRPDIIDPAVLRPGRLDKILYVGLPQEEDRVD
ILRAVTKNGTRPKLDKDVNLRDIAYKPECKGYSGADLAALVREAGIQSVKDFMSKTNADS
KASVTVSLDHFERALKKIRPSVSPEDQKYYESLKKKYSIQKS
Download sequence
Identical sequences E0W0U5
vb|PHUM563970-PA|EEB19251.1|conserved XP_002431989.1.24195 121224.XP_002431989

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]